Overview

  • Product name

  • Description

    Rabbit polyclonal to GTF3C5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GTF3C5 aa 355-424.
    Sequence:

    KTSSQLVTMHDLKQGLGPSGTSGARKPASSKYKLKDSVYIFREGALPPYR QMFYQLCDLNVEELQKIIHR


    Database link: Q9Y5Q8

  • Positive control

    • ICC/IF: MCF7 cells. WB: RT4 and U-251 MG cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab221809 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 59.6 kDa.

Target

  • Function

    Involved in RNA polymerase III-mediated transcription. Integral, tightly associated component of the DNA-binding TFIIIC2 subcomplex that directly binds tRNA and virus-associated RNA promoters.
  • Sequence similarities

    Belongs to the TFIIIC subunit 5 family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ20857 antibody
    • General transcription factor 3C polypeptide 5 antibody
    • General transcription factor IIIC polypeptide 5 63kDa antibody
    • GTF3C5 antibody
    • TF3C epsilon antibody
    • TF3C-epsilon antibody
    • TF3C5_HUMAN antibody
    • TFIIIC 63 kDa subunit antibody
    • TFiiiC2 63 antibody
    • TFIIIC63 antibody
    • TFIIICepsilon antibody
    • Transcription factor IIIC 63 kDa subunit antibody
    • Transcription factor IIIC epsilon subunit antibody
    • Transcription factor IIIC subunit epsilon antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized MCF7 (human breast adenocarcinoma cell line) cells stained for GTF3C5 (green) using ab221809 at 4 µg/ml in ICC/IF.

  • All lanes : Anti-GTF3C5 antibody (ab221809) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate

    Predicted band size: 59.6 kDa

References

ab221809 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221809.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up