Overview

  • Product name

  • Description

    Rabbit polyclonal to GTL3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Chicken, Cow, Xenopus laevis, Drosophila melanogaster, Zebrafish, Xenopus tropicalis
  • Immunogen

    Recombinant full length protein corresponding to Human GTL3 aa 1-193.
    Sequence:

    MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIE GTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVR RRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIE TLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ


    Database link: Q9Y6A4

  • Positive control

    • IHC-P: Human colon cancer tissue. Human skin tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab225952 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin embedded human skin tissue stained for GTL3 with ab225952 (1/100 dilution) in immunohistochemical analysis.

  • Paraffin embedded human colon cancer tissue stained for GTL3 with ab225952 (1/100 dilution) in immunohistochemical analysis.

References

ab225952 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225952.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up