Overview

  • Product name

    Anti-GTPBP5 antibody
  • Description

    Rabbit polyclonal to GTPBP5
  • Host species

    Rabbit
  • Specificity

    ab201092dDetects endogenous levels of GTPBP5 protein.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Orangutan
  • Immunogen

    Synthetic peptide corresponding to Human GTPBP5 aa 81-126.
    Sequence:

    CGGNGGAGASCFHSEPRKEFGGPDGGDGGNGGHVILRVDQQVKSLS


    Database link: Q9H4K7

  • Positive control

    • A549, Hela, PC12 and sp20 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab201092 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 44 kDa.

Target

Images

  • All lanes : Anti-GTPBP5 antibody (ab201092)

    Lane 1 : A549 whole cell lysate
    Lane 2 : Hela whole cell lysate
    Lane 3 : PC12 whole cell lysate
    Lane 4 : sp20 whole cell lysate

    Predicted band size: 44 kDa

References

ab201092 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201092.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up