Overview

  • Product name

  • Description

    Rabbit polyclonal to Guanylin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Guanylin aa 32-115.
    Sequence:

    SLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPL CKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC


    Database link: Q02747

  • Positive control

    • IHC-P: Human small intestine tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab223727 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 12 kDa.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins.
  • Tissue specificity

    Highly expressed in ileum and colon. Found in plasma.
  • Sequence similarities

    Belongs to the guanylin family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • GapI antibody
    • GCAP-I antibody
    • Guanylate cyclase activating protein 1 antibody
    • Guanylate cyclase activator 2A (guanylin 2 intestinal heat-stable) antibody
    • Guanylate cyclase activator 2A antibody
    • Guanylate cyclase-activating protein 1 antibody
    • Guanylate cyclase-activating protein I antibody
    • Guanylin antibody
    • GUC2A_HUMAN antibody
    • GUCA2 antibody
    • GUCA2A antibody
    • STARA antibody
    see all

Images

  • Paraffin embedded human small intestine tissue stained for Guanylin with ab223727 (1/1000 dilution) in immunohistochemical analysis.

  • All lanes : Anti-Guanylin antibody (ab223727) at 1/100 dilution

    Lane 1 : Control (vector only transfected HEK293T lysate)
    Lane 2 : Guanylin over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK-293T cells

    Predicted band size: 12 kDa

References

ab223727 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223727.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up