Overview

  • Product name

  • Description

    Rabbit polyclonal to GUCY1B3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISA, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide corresponding to Human GUCY1B3 aa 10-59. NP_000848.1
    Sequence:

    ELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVL


    Database link: Q02153

  • Positive control

    • HUVEC cell extract; Human brain, cerebellum tissue.
  • General notes

     This product was previously labelled as Guanylyl Cyclase beta 1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 0.87% Sodium chloride, 50% Glycerol

    (PBS is without Mg2+ and Ca2+)
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab189176 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 71 kDa.
ELISA 1/5000.
IHC-P Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.

Target

Images

  • All lanes : Anti-GUCY1B3 antibody (ab189176) at 1/500 dilution

    Lane 1 : HUVEC cell extract
    Lane 2 : HUVEC cell extract with synthesized peptide

    Predicted band size: 71 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human brain, cerebellum tissue labeling GUCY1B3 with ab189176 at 5 µg/ml.

References

ab189176 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189176.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up