Anti-GC-C antibody (ab122404)
Key features and details
- Rabbit polyclonal to GC-C
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-GC-C antibody
See all GC-C primary antibodies -
Description
Rabbit polyclonal to GC-C -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human GC-C aa 982-1067.
Sequence:EVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQRLQAEFSDMIA NSLQKRQAAGIRSQKPRRVASYKKGTLEYLQLNTTD
Database link: P25092 -
Positive control
- IHC-P: Human rectum and small intestine tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab122404 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
IHC-P
1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Receptor for the E.coli heat-stable enterotoxin (E.coli enterotoxin markedly stimulates the accumulation of cGMP in mammalian cells expressing GC-C). Also activated by the endogenous peptide guanylin. -
Sequence similarities
Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
Contains 1 guanylate cyclase domain.
Contains 1 protein kinase domain. -
Domain
The protein kinase domain is predicted to be catalytically inactive. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 2984 Human
- Omim: 601330 Human
- SwissProt: P25092 Human
- Unigene: 524278 Human
-
Alternative names
- GC-C antibody
- Guanylyl cyclase C antibody
- GUC2C antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab122404 has not yet been referenced specifically in any publications.