Overview

  • Product name

  • Description

    Rabbit polyclonal to GULP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human GULP aa 199-279.
    Sequence:

    VSAPPAGSMTPKSPSTDIFDMIPFSPISHQSSMPTRNGTQPPPVPSRSTE IKRDLFGAEPFDPFNCGAADFPPDIQSKLDE


    Database link: Q9UBP9

  • Positive control

    • WB: HepG2 whole cell lysate; Rat heart lysate. ICC/IF: HepG2 cells.
  • General notes

    Previously labelled as CED6. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236893 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/500.
WB 1/2000 - 1/10000. Predicted molecular weight: 34 kDa.

Target

  • Function

    May function as an adapter protein. Required for efficient phagocytosis of apoptotic cells. Modulates cellular glycosphingolipid and cholesterol transport. May play a role in the internalization and endosomal trafficking of various LRP1 ligands, such as PSAP. Increases cellular levels of GTP-bound ARF6.
  • Tissue specificity

    Widely expressed. Detected in macrophages, pancreas, kidney, skeletal muscle, heart, colon, intestine, lung, placenta and ovary.
  • Sequence similarities

    Belongs to the ced-6 family.
    Contains 1 PID domain.
  • Cellular localization

    Cytoplasm. May associate with the cytoplasmic side of the plasma membrane and early endosomes.
  • Information by UniProt
  • Database links

  • Alternative names

    • CED6 antibody
    • Cell death protein 6 homolog antibody
    • Engulfment adapter protein antibody
    • Engulfment adaptor PTB domain containing 1 antibody
    • GULP antibody
    • GULP, engulfment adaptor PTB domain containing 1 antibody
    • GULP1 antibody
    • GULP1_HUMAN antibody
    • Protein GULP antibody
    • PTB domain adapter protein CED 6 antibody
    • PTB domain adapter protein CED-6 antibody
    • PTB domain adaptor protein CED6 antibody
    • PTB domain-containing engulfment adapter protein 1 antibody
    see all

Images

  • All lanes : Anti-GULP antibody (ab236893) at 1/2000 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 2 : Rat heart tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 34 kDa

  • HepG2 (human liver hepatocellular carcinoma cell line) cells labeling GULP using ab236893 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236893 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236893.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up