Overview

  • Product name
    Anti-GWL antibody [RIPLY 74C]
    See all GWL primary antibodies
  • Description
    Mouse monoclonal [RIPLY 74C] to GWL
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human GWL aa 1-879.
    Sequence:

    MDPTAGSKKEPGGGAATEEGVNRIAVPKPPSIEEFSIVKPISRGAFGKVY LGQKGGKLYAVKVVKKADMINKNMTHQVQAERDALALSKSPFIVHLYYSL QSANNVYLVMEYLIGGDVKSLLHIYGYFDEEMAVKYISEVALALDYLHRH GIIHRDLKPDNMLISNEGHIKLTDFGLSKVTLNRDINMMDILTTPSMAKP RQDYSRTPGQVLSLISSLGFNTPIAEKNQDPANILSACLSETSQLSQGLV CPMSVDQKDTTPYSSKLLKSCLETVASNPGMPVKCLTSNLLQSRKRLATS SASSQSHTFISSVESECHSSPKWEKDCQESDEALGPTMMSWNAVEKLCAK SANAIETKGFNKKDLELALSPIHNSSALPTTGRSCVNLAKKCFSGEVSWE AVELDVNNINMDTDTSQLGFHQSNQWAVDSGGISEEHLGKRSLKRNFELV DSSPCKKIIQNKKTCVEYKHNEMTNCYTNQNTGLTVEVQDLKLSVHKSQQ NDCANKENIVNSFTDKQQTPEKLPIPMIAKNLMCELDEDCEKNSKRDYLS SSFLCSDDDRASKNISMNSDSSFPGISIMESPLESQPLDSDRSIKESSFE ESNIEDPLIVTPDCQEKTSPKGVENPAVQESNQKMLGPPLEVLKTLASKR NAVAFRSFNSHINASNNSEPSRMNMTSLDAMDISCAYSGSYPMAITPTQK RRSCMPHQQTPNQIKSGTPYRTPKSVRRGVAPVDDGRILGTPDYLAPELL LGRAHGPAVDWWALGVCLFEFLTGIPPFNDETPQQVFQNILKRDIPWPEG EEKLSDNAQSAVEILLTIDDTKRAGMKELKRHPLFSDVDWENLQHQTMPF IPQPDDETDTSYFEARNTAQHLTVSGFSL

  • Positive control
    • Human and Mouse GWL-transfected HEK cell lysates; Raji, Ramos, Dana and MT2 cell lysates; 293T and HeLa transfected cell lysates; Human tonsil, testicle, bone marrow, Hodgkin and Burkitt lymphoma tissues.
  • General notes

    Previously labelled as MASTL.

Properties

Applications

Our Abpromise guarantee covers the use of ab166647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/50. Predicted molecular weight: 97 kDa.
IHC-P 1/60. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Target

  • Function
    Serine/threonine kinase that plays a key role in M phase by acting as a regulator of mitosis entry and maintenance. Acts by promoting the inactivation of protein phosphatase 2A (PP2A) during M phase: does not directly inhibit PP2A but acts by mediating phosphorylation and subsequent activation of ARPP19 and ENSA at 'Ser-62' and 'Ser-67', respectively. ARPP19 and ENSA are phosphatase inhibitors that specifically inhibit the PPP2R2D (PR55-delta) subunit of PP2A. Inactivation of PP2A during M phase is essential to keep cyclin-B1-CDK1 activity high. Following DNA damage, it is also involved in checkpoint recovery by being inhibited. Phosphorylates histone protein in vitro; however such activity is unsure in vivo. May be involved in megakaryocyte differentiation.
  • Involvement in disease
    Defects in MASTL are the cause of thrombocytopenia type 2 (THC2) [MIM:188000]. Thrombocytopenia is defined by a decrease in the number of platelets in circulating blood, resulting in the potential for increased bleeding and decreased ability for clotting.
  • Sequence similarities
    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylation at Thr-741 by CDK1 during M phase activates its kinase activity (By similarity). Maximum phosphorylation occurs in prometaphase.
  • Cellular localization
    Cytoplasm > cytoskeleton > centrosome. Nucleus. Cleavage furrow. During interphase is mainly nuclear, upon nuclear envelope breakdown localizes at the cytoplasm and during mitosis at the centrosomes. Upon mitotic exit moves to the cleavage furrow.
  • Information by UniProt
  • Database links
  • Alternative names
    • 2700091H24Rik antibody
    • C88295 antibody
    • FLJ14813 antibody
    • GREATWALL antibody
    • Greatwall protein kinase antibody
    • GW antibody
    • GWL antibody
    • GWL_HUMAN antibody
    • hGWL antibody
    • MAST-L antibody
    • Mastl antibody
    • MGC117975 antibody
    • Microtubule associated serine/threonine kinase like antibody
    • Microtubule-associated serine/threonine-protein kinase-like antibody
    • RP11 85G18.2 antibody
    • Serine/threonine-protein kinase greatwall antibody
    • THC2 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human tonsil tissue labeling GWL with ab166647 at 1/15 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human testicle tissue labeling GWL with ab166647 at 1/15 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human bone marrow tissue labeling GWL with ab166647 at 1/15 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human Hodgkin lymphoma tissue labeling GWL with ab166647 at 1/15 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human Burkitt lymphoma tissue labeling GWL with ab166647 at 1/15 dilution.

  • All lanes : Anti-GWL antibody [RIPLY 74C] (ab166647) at 1/50 dilution

    Lane 1 : Human GWL transfected HEK cell lysate
    Lane 2 : Mouse GWL transfected HEK cell lysate
    Lane 3 : FLT4 transfected HEK cell lysate
    Lane 4 : Raji cell lysate
    Lane 5 : Ramos cell lysate
    Lane 6 : Dana cell lysate
    Lane 7 : MT2 cell lysate
    Lane 8 : Human tonsil lysate
    Lane 9 : Human testis lysate

    Predicted band size: 97 kDa

  • All lanes : Anti-GWL antibody [RIPLY 74C] (ab166647) at 1/50 dilution

    Lane 1 : Mock transfected 293T cell lysate
    Lane 2 : V5-mouse GWL transfected 293T cell lysate
    Lane 3 : shCtrl transfected HeLa cell lysate
    Lane 4 : shGWL transfected HeLa cell lysate

    Lysates/proteins at 40 µg per lane.

    Predicted band size: 97 kDa

References

ab166647 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166647.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up