Overview

  • Product name

  • Description

    Rabbit polyclonal to GYPB/GPB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: Flow Cyt, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human GYPB/GPB aa 20-59 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    LSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPA


    Database link: P06028

  • Positive control

    • Human placenta tissue.
  • General notes

     This product was previously labelled as GYPB

     

Properties

Applications

Our Abpromise guarantee covers the use of ab203341 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/20 - 1/100.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

 

IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200

Target

  • Function

    This protein is a minor sialoglycoprotein in erythrocyte membranes.
  • Sequence similarities

    Belongs to the glycophorin-A family.
  • Post-translational
    modifications

    The N-terminal extracellular domain is heavily glycosylated on serine and threonine residues.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD235b antibody
    • GLPB_HUMAN antibody
    • Glycophorin-B antibody
    • GYPB antibody
    • PAS-3 antibody
    • Sialoglycoprotein delta antibody
    • SS-active sialoglycoprotein antibody
    see all

Images

  • Immunohistochemistry of Formalin-fixed and paraffin embedded Human placenta tissue labeling GYPB/GPB with ab203341 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

ab203341 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203341.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up