Overview

  • Product name
  • Description
    Rabbit polyclonal to H Cadherin
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human, Pig
    Predicted to work with: Mouse, Cow, Orangutan
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human H Cadherin aa 179-366. (Expressed in E.coli).
    Sequence:

    GVDQEPKGIFRINENTGSVSVTRTLDREVIAVYQLFVETTDVNGKTLEGP VPLEVIVIDQNDNRPIFREGPYIGHVMEGSPTGTTVMRMTAFDADDPATD NALLRYNIRQQTPDKPSPNMFYIDPEKGDIVTVVSPALLDRETLENPKYE LIIEAQDMAGLDVGLTGTATATIMIDDKNDHSPKFTKK


    Database link: P55290

  • Positive control
    • WB: Recombinant human H Cadherin; Pig cerebrum tissue lysate. IHC-P: Human liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232806 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 78 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function
    Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. May act as a negative regulator of neural cell growth.
  • Tissue specificity
    Highly expressed in heart. In the CNS, expressed in cerebral cortex, medulla, hippocampus, amygdala, thalamus and substantia nigra. No expression detected in cerebellum or spinal cord.
  • Sequence similarities
    Contains 5 cadherin domains.
  • Developmental stage
    Expressed at higher levels in adult brain than in developing brain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CAD13_HUMAN antibody
    • Cadherin-13 antibody
    • CDH13 antibody
    • CDHH antibody
    • H-cadherin antibody
    • Heart cadherin antibody
    • P105 antibody
    • T cad antibody
    • T Cadherin antibody
    • T-cad antibody
    • T-cadherin antibody
    • Truncated cadherin antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for H Cadherin using ab232806 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-H Cadherin antibody (ab232806) at 2 µg/ml + Recombinant human H Cadherin protein

    Predicted band size: 78 kDa

  • Anti-H Cadherin antibody (ab232806) at 1.5 µg/ml + Pig cerebrum tissue lysate

    Developed using the ECL technique.

    Predicted band size: 78 kDa

References

ab232806 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232806.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up