Overview

  • Product name

  • Description

    Rabbit polyclonal to H Cadherin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Pig
    Predicted to work with: Cow, Human, Orangutan
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human H Cadherin aa 23-133. (Expressed in E.coli).
    Sequence:

    EDLDCTPGFQQKVFHINQPAEFIEDQSILNLTFSDCKGNDKLRYEVSSPY FKVNSDGGLVALRNITAVGKTLFVHARTPHAEDMAELVIVGGKDIQGSLQ DIFKFARTSPV


    Database link: P55290

  • Positive control

    • WB: Pig cerebrum lysate; Recombinant human H Cadherin protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab232893 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 78 kDa.

Target

  • Function

    Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. May act as a negative regulator of neural cell growth.
  • Tissue specificity

    Highly expressed in heart. In the CNS, expressed in cerebral cortex, medulla, hippocampus, amygdala, thalamus and substantia nigra. No expression detected in cerebellum or spinal cord.
  • Sequence similarities

    Contains 5 cadherin domains.
  • Developmental stage

    Expressed at higher levels in adult brain than in developing brain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CAD13_HUMAN antibody
    • Cadherin-13 antibody
    • CDH13 antibody
    • CDHH antibody
    • H-cadherin antibody
    • Heart cadherin antibody
    • P105 antibody
    • T cad antibody
    • T Cadherin antibody
    • T-cad antibody
    • T-cadherin antibody
    • Truncated cadherin antibody
    see all

Images

  • Anti-H Cadherin antibody (ab232893) at 2 µg/ml + Recombinant human H Cadherin protein

    Predicted band size: 78 kDa

  • Anti-H Cadherin antibody (ab232893) at 1.5 µg/ml + Pig cerebrum lysate

    Secondary
    HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody at 0.2 µg/ml

    Predicted band size: 78 kDa

References

ab232893 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232893.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up