Overview

  • Product name

  • Description

    Rabbit polyclonal to H-ERA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human H-ERA aa 271-382.
    Sequence:

    HSHPGTHCPSPAVKDPNTQSVGNPQRIGWPHFKEIFMLSALSQEDVKTLK QYLLTQAQPGPWEYHSAVLTSQTPEEICANIIREKLLEHLPQEVPYNVQQ KTAVWEEGPGGE


    Database link: O75616-1

  • Positive control

    • IHC-P: Human colon cancer, glioma and melanoma tissue. ICC/IF: A549 cells.
  • General notes

    Previously labelled as GTP binding protein era homolog.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238496 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Probable GTPase that plays a role in the mitochondrial ribosomal small subunit assembly. Specifically binds the 12S mitochondrial rRNA (12S mt-rRNA) to a 33 nucleotide section delineating the 3' terminal stem-loop region. May act as a chaperone that protects the 12S mt-rRNA on the 28S mitoribosomal subunit during ribosomal small subunit assembly.
  • Sequence similarities

    Belongs to the Era/MnmE GTP-binding protein family. Era subfamily.
    Contains 1 G (guanine nucleotide-binding) domain.
    Contains 1 KH type-2 domain.
  • Cellular localization

    Mitochondrion matrix. Mitochondrion inner membrane. Localizes on the matrix side on the mitochondrial inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CEGA antibody
    • Conserved ERA like GTPase antibody
    • Conserved ERA-like GTPase antibody
    • ERA antibody
    • Era (E. coli G protein homolog) like 1 antibody
    • Era G protein like 1 (E. coli) antibody
    • Era G protein like 1 antibody
    • ERA W antibody
    • ERA-like protein 1 antibody
    • ERA-W antibody
    • Eral1 antibody
    • ERAL1_HUMAN antibody
    • ERAL1A antibody
    • ERAW antibody
    • GTP binding protein era homolog antibody
    • GTPase Era antibody
    • GTPase Era, mitochondrial antibody
    • GTPase human homolog of E. coli essential cell cycle protein Era antibody
    • H-ERA antibody
    • HERA A antibody
    • hERA antibody
    • HERA B antibody
    • HERAA antibody
    • HERAB antibody
    • mitochondrial antibody
    see all

Images

  • A549 (human lung carcinoma cell line) cells stained for H-ERA (Green) using ab238496 at a 1/100 dilution in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human colon cancer tissue stained for H-ERA with ab238496 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human melanoma tissue stained for H-ERA with ab238496 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human glioma tissue stained for H-ERA with ab238496 at a 1/100 dilution in immunohistochemical analysis.

References

ab238496 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238496.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up