Overview

  • Product name

  • Description

    Rabbit polyclonal to H-FABP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Pig
    Predicted to work with: Cow, Human
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Pig H-FABP aa 2-133. (Expressed in E.coli).
    Sequence:

    VDAFAGTWKLVDSKNFDDYMKSIGVGFATRQVANMTKPTTIIEVNGDTII IKTQSTFKSTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWNGQ ETTLVRELVDGKLILTLTHGSAVCTRTYEKEA


    Database link: O02772

  • Positive control

    • WB: Recombinant pig H-FABP protein; Mouse heart lysate; Pig heart and skeletal muscle lysates. IHC-P: Pig heart and spleen tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab231568 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 15 kDa.

Target

  • Function

    FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
  • Sequence similarities

    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Domain

    Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 422 protein antibody
    • Cardiac FABP antibody
    • Cardiac Fatty Acid Binding Protein antibody
    • FABP 11 antibody
    • FABP 3 antibody
    • FABP11 antibody
    • FABP3 antibody
    • FABPH_HUMAN antibody
    • Fatty acid binding protein 11 antibody
    • Fatty acid binding protein 3 antibody
    • Fatty acid binding protein 3 muscle and heart antibody
    • Fatty acid binding protein 3 muscle and heart mammary derived growth inhibitor antibody
    • Fatty acid binding protein 3 muscle antibody
    • Fatty acid binding protein 3, muscle and heart (mammary derived growth inhibitor) antibody
    • Fatty acid binding protein 3, muscle antibody
    • Fatty acid binding protein heart antibody
    • Fatty acid binding protein, heart antibody
    • Fatty acid binding protein, muscle and heart antibody
    • Fatty acid binding protein, skeletal muscle antibody
    • Fatty acid-binding protein 3 antibody
    • Fatty acid-binding protein antibody
    • H FABP antibody
    • H-FABP antibody
    • heart antibody
    • Heart type fatty acid binding protein antibody
    • Heart-type fatty acid-binding protein antibody
    • M FABP antibody
    • M-FABP antibody
    • Mammary derived growth inhibitor antibody
    • Mammary-derived growth inhibitor antibody
    • MDGI antibody
    • Muscle fatty acid binding protein antibody
    • Muscle fatty acid-binding protein antibody
    • Mylein protein P2 homolog antibody
    • O FABP antibody
    • OTTHUMP00000003898 antibody
    • P2 adopocyte protein antibody
    see all

Images

  • Anti-H-FABP antibody (ab231568) at 2 µg/ml + Recombinant pig H-FABP protein

    Predicted band size: 15 kDa

  • Anti-H-FABP antibody (ab231568) at 2 µg/ml + Mouse heart lysate

    Predicted band size: 15 kDa

  • Anti-H-FABP antibody (ab231568) at 2 µg + Pig heart lysate

    Predicted band size: 15 kDa

  • Anti-H-FABP antibody (ab231568) at 2 µg/ml + Pig skeletal muscle lysate

    Predicted band size: 15 kDa

  • All lanes : Anti-H-FABP antibody (ab231568) at 3 µg/ml

    Lane 1 : Pig heart lysate
    Lane 2 : Pig skeletal muscle lysate
    Lane 3 : Mouse heart lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/1000 dilution

    Predicted band size: 15 kDa

  • Paraffin-embedded pig spleen tissue stained for H-FABP using ab231568 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded pig heart tissue stained for H-FABP using ab231568 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231568 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231568.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up