Overview

  • Product name

    Anti-H-protein antibody [OTI3G1]
    See all H-protein primary antibodies
  • Description

    Mouse monoclonal [OTI3G1] to H-protein
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human H-protein aa 1-477. H-protein (NP_004988) produced in HEK-293T cell.
    Sequence:

    MMEKNTSEGPACSPEETASESAKVPTAEPPGEVAVSESTREEQVPKPQAP APQAPTASTATKPAPPSEDVPSAPLLLTLDDVSSSSVTVSWEPPERLGRL GLQGYVLELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSS AGAGPPAMLDQPIHIRENIEAPKIRVPRHLRQTYIRQVGETVNLQIPFQG KPKPQATWTHNGHALDSQRVSMRTGDQDSILFIRSAQRSDSGRYELTVRV EDLEAKAVIDILVIEKPGPPSSIRLLDVWGCNAALQWTPPQDTGNTELLG YMVQKADKKTGQWFTVLERYHPTTCTISDLIIGNSYSFRVFSENLCGLST SATVTKELAHIQKADIAAKPKGFIERDFSEAPSFTQPLADHTSTPGYSTQ LFCSVRASPKPKIIWMKNKMEIQGNPKYRALSEQGVCTLEIRKPSPFDSG VYTCKAINVLGEASVDCRLEVKASAAH


    Database link: Q13203

  • Positive control

    • Human colon adenocarcinoma tissue, Human lung carcinoma tissue and Human pancreas tissue. HeLa cells.
  • General notes

    The clone number has been updated from 3G1 to OTI3G1, both clone numbers name the same clone.

    Previously labelled as MYBPH.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    OTI3G1
  • Isotype

    IgG2a
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab156763 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/4000. Predicted molecular weight: 52 kDa.
IHC-P 1/150.
ICC/IF 1/100.

Target

  • Function

    Binds to myosin; probably involved in interaction with thick myofilaments in the A-band.
  • Tissue specificity

    Skeletal muscle.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. MyBP family.
    Contains 2 fibronectin type-III domains.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • bHLHe38 antibody
    • H protein antibody
    • H-protein antibody
    • l-myc protein antibody
    • l-myc-1 proto-oncogene antibody
    • LMYC antibody
    • MyBP H antibody
    • MyBP-H antibody
    • Mybph antibody
    • MYBPH_HUMAN antibody
    • myc-related gene from lung cancer antibody
    • MYCL antibody
    • Myosin binding protein H antibody
    • Myosin binding protein, 86-KD antibody
    • Myosin-binding protein H antibody
    • Oncogene lmyc antibody
    • V-myc avian myelocytomatosis viral oncogene homolog 1, lung carcinoma derived antibody
    see all

Images

  • All lanes : Anti-H-protein antibody [OTI3G1] (ab156763) at 1/4000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
    Lane 2 : HEK-293T cells transfected with pCMV6-ENTRY H-protein

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 52 kDa

  • Immunofluorescence analysis of COS7 cells transiently transfected by pCMV6-ENTRY H-protein labeling H-protein with ab156763 at 1/100.

  • Paraffin embedded Human colon adenocarcinoma tissue labeling H-protein with ab156763 at 1/150 in immunohistochemical analysis.

  • Paraffin embedded Human lung carcinoma tissue labeling H-protein with ab156763 at 1/150 in immunohistochemical analysis.

  • Paraffin embedded Human pancreas tissue labeling H-protein with ab156763 at 1/150 in immunohistochemical analysis.

References

ab156763 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156763.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up