Overview

  • Product name

  • Description

    Rabbit polyclonal to HABP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human HABP2 aa 24-560. (Expressed in E.coli).
    Sequence:

    FSLMSLLESLDPDWTPDQYDYSYEDYNQEENTSSTLTHAENPDWYYTEDQ ADPCQPNPCEHGGDCLVHGSTFTCSCLAPFSGNKCQKVQNTCKDNPCGRG QCLITQSPPYYRCVCKHPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSK FTCACPDQFKGKFCEIGSDDCYVGDGYSYRGKMNRTVNQHACLYWNSHLL LQENYNMFMEDAETHGIGEHNFCRNPDADEKPWCFIKVTNDKVKWEYCDV SACSAQDVAYPEESPTEPSTKLPGFDSCGKTEIAERKIKRIYGGFKSTAG KHPWQASLQSSLPLTISMPQGHFCGGALIHPCWVLTAAHCTDIKTRHLKV VLGDQDLKKEEFHEQSFRVEKIFKYSHYNERDEIPHNDIALLKLKPVDGH CALESKYVKTVCLPDGSFPSGSECHISGWGVTETGKGSRQLLDAKVKLIA NTLCNSRQLYDHMIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYV YGIVSWGLECGKRPGVYTQVTKFLNWIKATIKSESGF


    Database link: Q14520

  • Positive control

    • IHC-P: Human rectum tissue. WB: Recombinant human HABP2 protein; Pig liver, kidney and small intestine lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab232778 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232778 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 63 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Cleaves the alpha-chain at multiple sites and the beta-chain between 'Lys-53' and 'Lys-54' but not the gamma-chain of fibrinogen and therefore does not initiate the formation of the fibrin clot and does not cause the fibrinolysis directly. It does not cleave (activate) prothrombin and plasminogen but converts the inactive single chain urinary plasminogen activator (pro-urokinase) to the active two chain form. Activates coagulation factor VII.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 3 EGF-like domains.
    Contains 1 kringle domain.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications

    Proteolytic cleavage at Gly-23 or Met-27 can give rise to the 50 kDa heavy chain and cleavage at Arg-313 or Lys-319 can give rise to the 27 kDa light chain. The heavy chain can undergo further proteolytic cleavage at Lys-169 or Arg-170 to give rise to 2 inactive 26 kDa fragments and the light chain can undergo further proteolytic cleavage at Arg-480 to give rise to inactive 17 kDa and 8 kDa fragments.
  • Cellular localization

    Secreted. Secreted as an inactive single-chain precursor and is then activated to a heterodimeric form.
  • Information by UniProt
  • Database links

  • Alternative names

    • Factor seven activating protease antibody
    • Factor seven-activating protease antibody
    • Factor VII activating protein antibody
    • Factor VII-activating protease antibody
    • FSAP antibody
    • HABP 2 antibody
    • HABP antibody
    • Habp2 antibody
    • HABP2_HUMAN antibody
    • Hepatocyte growth factor activator like protein antibody
    • Hepatocyte growth factor activator-like protein antibody
    • HGFAL antibody
    • Hyaluronan binding protein 2 antibody
    • Hyaluronan-binding protein 2 27 kDa light chain alternate form antibody
    • Hyaluronic acid binding protein 2 antibody
    • PHBP antibody
    • Plasma hyaluronan binding protein antibody
    • Plasma hyaluronan-binding protein antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human rectum tissue stained for HABP2 using ab232778 at 20µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-HABP2 antibody (ab232778) at 2 µg/ml + Recombinant human HABP2 protein.

    Predicted band size: 63 kDa

  • All lanes : Anti-HABP2 antibody (ab232778) at 1 µg/ml

    Lane 1 : Pig kidney tissue lysate
    Lane 2 : Pig intestine tissue lysate
    Lane 3 : Pig liver tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/1000 dilution

    Predicted band size: 63 kDa

References

ab232778 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232778.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up