Overview

  • Product name

  • Description

    Rabbit polyclonal to HADH
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human HADH aa 1-236. Expressed in E. coli. N-terminal tags.
    Sequence:

    MAFVTRQFMRSVSSSSTASASAKKIIVKHVTVIGGGLMGAGIAQVAAATG HTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTI ATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSS LQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDF SKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYER


    Database link: Q16836

  • Positive control

    • IHC-P: Human liver tissue. WB: Recombinant human HADH protein. Pig skeletal muscle, heart and kidney tissue lysate. Human serum. Human liver tissue lysate.
  • General notes

     This product was previously labelled as HADHSC

     

Properties

Applications

Our Abpromise guarantee covers the use of ab232969 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.

Target

  • Function

    Plays an essential role in the mitochondrial beta-oxidation of short chain fatty acids. Exerts it highest activity toward 3-hydroxybutyryl-CoA.
  • Tissue specificity

    Expressed in liver, kidney, pancreas, heart and skeletal muscle.
  • Pathway

    Lipid metabolism; fatty acid beta-oxidation.
  • Involvement in disease

    Defects in HADH are the cause of 3-alpha-hydroxyacyl-CoA dehydrogenase deficiency (HADH deficiency) [MIM:231530]. HADH deficiency is a metabolic disorder with various clinical presentations including hypoglycemia, hepatoencephalopathy, myopathy or cardiomyopathy, and in some cases sudden death.
    Defects in HADH are the cause of familial hyperinsulinemic hypoglycemia type 4 (HHF4) [MIM:609975]; also known as persistent hyperinsulinemic hypoglycemia of infancy (PHHI) or congenital hyperinsulinism. HHF is the most common cause of persistent hypoglycemia in infancy and is due to defective negative feedback regulation of insulin secretion by low glucose levels. It causes nesidioblastosis, a diffuse abnormality of the pancreas in which there is extensive, often disorganized formation of new islets. Unless early and aggressive intervention is undertaken, brain damage from recurrent episodes of hypoglycemia may occur. HHF4 should be easily recognizable by analysis of acylcarnitine species and that this disorder responds well to treatment with diazoxide. It provides the first 'experiment of nature' that links impaired fatty acid oxidation to hyperinsulinism and that provides support for the concept that a lipid signaling pathway is implicated in the control of insulin secretion.
  • Sequence similarities

    Belongs to the 3-hydroxyacyl-CoA dehydrogenase family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3 hydroxyacyl Coenzyme A dehydrogenase antibody
    • HAD antibody
    • HADH antibody
    • HADH1 antibody
    • HADHSC antibody
    • HADHSC, formerly antibody
    • HADSC, formerly antibody
    • HCDH antibody
    • HCDH_HUMAN antibody
    • HHF4 antibody
    • Hydroxyacyl CoA dehydrogenase antibody
    • Hydroxyacyl-coenzyme A dehydrogenase antibody
    • hydroxyacyl-coenzyme A dehydrogenase, mitochondrial antibody
    • L 3 hydroxyacyl Coenzyme A dehydrogenase short chain antibody
    • M SCHAD antibody
    • Medium and short chain L 3 hydroxyacyl coenzyme A dehydrogenase antibody
    • Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase antibody
    • MGC8392 antibody
    • mitochondrial antibody
    • MSCHAD antibody
    • OTTHUMP00000162626 antibody
    • OTTHUMP00000219688 antibody
    • SCHAD antibody
    • SCHAD, formerly antibody
    • Short chain 3 hydroxyacyl CoA dehydrogenase mitochondrial antibody
    • short chain 3-hydroxyacyl-coa dehydrogenase antibody
    • Short-chain 3-hydroxyacyl-CoA dehydrogenase antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for HADH with ab232969 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-HADH antibody (ab232969) at 1 µg/ml + Human serum

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
  • Anti-HADH antibody (ab232969) at 1 µg/ml + Pig skeletal muscle tissue lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
  • Anti-HADH antibody (ab232969) at 1 µg/ml + Human liver tissue lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
  • Anti-HADH antibody (ab232969) at 1 µg/ml + Pig kidney tissue lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
  • Anti-HADH antibody (ab232969) at 1 µg/ml + Pig heart tissue lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
  • Anti-HADH antibody (ab232969) at 2 µg/ml + Recombinant human HADH protein

References

ab232969 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232969.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up