Overview

  • Product name

  • Description

    Rabbit polyclonal to HADHB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human HADHB aa 11-101.
    Sequence:

    LPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGV RTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYI


    Database link: P55084

  • Positive control

    • ICC/IF: U-2 OS cells. WB: RT4 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab221644 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 51 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Pathway

    Lipid metabolism; fatty acid beta-oxidation.
  • Involvement in disease

    Defects in HADHB are a cause of trifunctional protein deficiency (TFP deficiency) [MIM:609015]. The clinical manifestations are very variable and include hypoglycemia, cardiomyopathy and sudden death. Phenotypes with mainly hepatic and neuromyopathic involvement can also be distinguished. Biochemically, TFP deficiency is defined by the loss of all three enzyme activities of the TFP complex.
  • Sequence similarities

    Belongs to the thiolase family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

    • Alternative names

      • 2 enoyl Coenzyme A (CoA) hydratase beta subunit antibody
      • 3 ketoacyl Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein beta subunit antibody
      • 3 ketoacyl Coenzyme A thiolase antibody
      • 3 ketoacyl Coenzyme A thiolase of mitochondrial trifunctional protein beta subunit antibody
      • 3-ketoacyl-CoA thiolase antibody
      • Acetyl CoA acyltransferase antibody
      • Acetyl-CoA acyltransferase antibody
      • Beta ketothiolase antibody
      • Beta-ketothiolase antibody
      • ECHB antibody
      • ECHB_HUMAN antibody
      • HADH antibody
      • Hadhb antibody
      • Hydroxyacyl CoA dehydrogenase/3 ketoacyl CoA thiolase/enoyl CoA hydratase (trifunctional protein), beta subunit antibody
      • Hydroxyacyl Coenzyme A (CoA) dehydrogenase beta subunit antibody
      • Hydroxyacyl Coenzyme A dehydrogenase antibody
      • Hydroxyacyl Coenzyme A dehydrogenase beta subunit antibody
      • Hydroxyacyl Coenzyme A dehydrogenase/3 ketoacyl Coenzyme A thiolase/enoyl Coenzyme A hydratase (trifunctional protein) beta subunit antibody
      • MGC87480 antibody
      • Mitochondrial trifunctional enzyme beta subunit antibody
      • Mitochondrial trifunctional protein beta subunit antibody
      • MSTP 029 antibody
      • MSTP029 antibody
      • MTPB antibody
      • TP beta antibody
      • TP-beta antibody
      • TPbeta antibody
      • Trifunctional enzyme subunit beta antibody
      • Trifunctional enzyme subunit beta mitochondrial antibody
      • Trifunctional protein antibody
      see all

    Images

    • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for HADHB (green) using ab221644 at 4 µg/ml in ICC/IF. 

       

    • All lanes : Anti-HADHB antibody (ab221644) at 0.4 µg

      Lane 1 : RT-4 cell lysate
      Lane 2 : U-251 MG cell lysate

      Predicted band size: 51 kDa

    References

    ab221644 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab221644.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up