Overview

  • Product name

  • Description

    Rabbit polyclonal to HADHB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse HADHB aa 1-259. (Expressed in E.coli).
    Sequence:

    MTTILTSTFRNLSTTSKWALRSSIRPLSCSSQLHSAPAVQTKSKKTLAKP NMKNIVVVEGVRIPFLLSGTSYKDLMPHDLARAALSGLLHRTNIPKDVVD YIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISSNQAMTTAV GLIASGQCDVVVAGGVELMSDVPIRHSRNMRKMMLDLNKAKTLGQRLSLL SKFRLNFLSPELPAVAEFSTNETMGHSADRLAAAFAVSRMEQDEYALRSH SLAKKAQDE


    Database link: Q99JY0

  • Positive control

    • WB: Mouse testis, lung and heart lysate; Recombinant mouse HADHB protein. IHC-P: Mouse brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233447 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 51 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Pathway

    Lipid metabolism; fatty acid beta-oxidation.
  • Involvement in disease

    Defects in HADHB are a cause of trifunctional protein deficiency (TFP deficiency) [MIM:609015]. The clinical manifestations are very variable and include hypoglycemia, cardiomyopathy and sudden death. Phenotypes with mainly hepatic and neuromyopathic involvement can also be distinguished. Biochemically, TFP deficiency is defined by the loss of all three enzyme activities of the TFP complex.
  • Sequence similarities

    Belongs to the thiolase family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2 enoyl Coenzyme A (CoA) hydratase beta subunit antibody
    • 3 ketoacyl Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein beta subunit antibody
    • 3 ketoacyl Coenzyme A thiolase antibody
    • 3 ketoacyl Coenzyme A thiolase of mitochondrial trifunctional protein beta subunit antibody
    • 3-ketoacyl-CoA thiolase antibody
    • Acetyl CoA acyltransferase antibody
    • Acetyl-CoA acyltransferase antibody
    • Beta ketothiolase antibody
    • Beta-ketothiolase antibody
    • ECHB antibody
    • ECHB_HUMAN antibody
    • HADH antibody
    • Hadhb antibody
    • Hydroxyacyl CoA dehydrogenase/3 ketoacyl CoA thiolase/enoyl CoA hydratase (trifunctional protein), beta subunit antibody
    • Hydroxyacyl Coenzyme A (CoA) dehydrogenase beta subunit antibody
    • Hydroxyacyl Coenzyme A dehydrogenase antibody
    • Hydroxyacyl Coenzyme A dehydrogenase beta subunit antibody
    • Hydroxyacyl Coenzyme A dehydrogenase/3 ketoacyl Coenzyme A thiolase/enoyl Coenzyme A hydratase (trifunctional protein) beta subunit antibody
    • MGC87480 antibody
    • Mitochondrial trifunctional enzyme beta subunit antibody
    • Mitochondrial trifunctional protein beta subunit antibody
    • MSTP 029 antibody
    • MSTP029 antibody
    • MTPB antibody
    • TP beta antibody
    • TP-beta antibody
    • TPbeta antibody
    • Trifunctional enzyme subunit beta antibody
    • Trifunctional enzyme subunit beta mitochondrial antibody
    • Trifunctional protein antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse brain tissue stained for HADHB using ab233447 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-HADHB antibody (ab233447) at 1 µg/ml

    Lane 1 : Mouse lung lysate
    Lane 2 : Mouse heart lysate
    Lane 3 : Mouse testis lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-rabbit at 1/1000 dilution

    Predicted band size: 51 kDa

  • Anti-HADHB antibody (ab233447) at 2 µg/ml + Recombinant mouse HADHB protein

    Predicted band size: 51 kDa

References

ab233447 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233447.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up