Hainantoxin-IV, TTX-sensitive voltage-gated Na+ channel blocker (ab146038)
Key features and details
- Potent, selective TTX-sensitive voltage-gated Na+ channel blocker
- CAS Number:
- Purity: > 98%
- Soluble in aqueous buffer
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
Hainantoxin-IV, TTX-sensitive voltage-gated Na+ channel blocker -
Description
Potent, selective TTX-sensitive voltage-gated Na+ channel blocker -
Biological description
Potent, selective TTX-sensitive voltage-gated Na+ channel blocker (IC50 = 45 nM). Hainantoxin-III (ab146037) analog. Shows analgesic effects in vivo. -
Purity
> 98% -
Chemical structure
Properties
-
Molecular weight
3987.54 -
Molecular formula
C166H257N53O50S6 -
Sequence
ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI (Modifications: C-terminal amide; Disulfide bonds: 2-17, 9-24, 16-31) -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in aqueous buffer -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab146038 has not yet been referenced specifically in any publications.