Overview

  • Product name
    Anti-Hamartin antibody [OTI3A2]
    See all Hamartin primary antibodies
  • Description
    Mouse monoclonal [OTI3A2] to Hamartin
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Hamartin aa 836-1164. Produced in E.coli.
    Sequence:

    SNSESVQQQMEFLNRQLLVLGEVNELYLEQLQNKHSDTTKEVEMMKAAYR KELEKNRSHVLQQTQRLDTSQKRILELESHLAKKDHLLLEQKKYLEDVKL QARGQLQAAESRYEAQKRITQVFELEILDLYGRLEKDGLLKKLEEEKAEA AEAAEERLDCCNDGCSDSMVGHNEEASGHNGETKTPRPSSARGSSGSRGG GGSSSSSSELSTPEKPPHQRAGPFSSRWETTMGEASASIPTTVGSLPSSK SFLGMKARELFRNKSESQCDEDGMTSSLSESLKTELGKDLGVEAKIPLNL DGPHPSPPTPDSVGQLHIMDYNETHHEHS


    Database link: NP_000359

  • Positive control
    • HEK293T cell lysate transfected with pCMV6-ENTRY Hamartin cDNA; Human breast, colon, colon adenocarcinoma, pancreas, endometrium adenocarcinoma, prostate and prostate carcinoma tissues.
  • General notes

    The clone number has been updated from 3A2 to OTI3A2, both clone numbers name the same clone.

Properties

Applications

Our Abpromise guarantee covers the use of ab170164 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 130 kDa.
IHC-P 1/150.

Target

  • Function
    In complex with TSC2, inhibits the nutrient-mediated or growth factor-stimulated phosphorylation of S6K1 and EIF4EBP1 by negatively regulating mTORC1 signaling. Seems not to be required for TSC2 GAP activity towards RHEB. Implicated as a tumor suppressor. Involved in microtubule-mediated protein transport, but this seems to be due to unregulated mTOR signaling.
  • Tissue specificity
    Highly expressed in skeletal muscle, followed by heart, brain, placenta, pancreas, lung, liver and kidney. Also expressed in embryonic kidney cells.
  • Involvement in disease
    Defects in TSC1 are the cause of tuberous sclerosis type 1 (TSC1) [MIM:191100]. It is an autosomal dominant multi-system disorder that affects especially the brain, kidneys, heart, and skin. TS1C is characterized by hamartomas (benign overgrowths predominantly of a cell or tissue type that occurs normally in the organ) and hamartias (developmental abnormalities of tissue combination). Clinical symptoms can range from benign hypopigmented macules of the skin to profound mental retardation with intractable seizures to premature death from a variety of disease-associated causes.
    Defects in TSC1 may be a cause of focal cortical dysplasia of Taylor balloon cell type (FCDBC) [MIM:607341]. FCDBC is a subtype of cortical displasias linked to chronic intractable epilepsy. Cortical dysplasias display a broad spectrum of structural changes, which appear to result from changes in proliferation, migration, differentiation, and apoptosis of neuronal precursors and neurons during cortical development.
  • Domain
    The C-terminal putative coiled-coil domain is necessary for interaction with TSC2.
  • Post-translational
    modifications
    Phosphorylation at Ser-505 does not affect interaction with TSC2. Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm. Membrane. At steady state found in association with membranes.
  • Information by UniProt
  • Database links
  • Alternative names
    • Hamartin antibody
    • kiaa0243 antibody
    • LAM antibody
    • TSC antibody
    • Tsc1 antibody
    • Tsc1 gene antibody
    • TSC1_HUMAN antibody
    • Tuberous sclerosis 1 antibody
    • Tuberous sclerosis 1 protein antibody
    • tumor suppressor antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human breast tissue labeling Hamartin with ab170164 at 1/150 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human colon tissue labeling Hamartin with ab170164 at 1/150 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human colon adenocarcinoma tissue labeling Hamartin with ab170164 at 1/150 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human pancreas tissue labeling Hamartin with ab170164 at 1/150 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human endometrium adenocarcinoma tissue labeling Hamartin with ab170164 at 1/150 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human prostate tissue labeling Hamartin with ab170164 at 1/150 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human prostate carcinoma tissue labeling Hamartin with ab170164 at 1/150 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human adult heart tissue tissue labeling Hamartin with ab170164 at 1/150 dilution.

  • All lanes : Anti-Hamartin antibody [OTI3A2] (ab170164) at 1/2000 dilution

    Lane 1 : HEK293T cell lysate transfected with pCMV6-ENTRY control
    Lane 2 : HEK293T cell lysate transfected with pCMV6-ENTRY Hamartin cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 130 kDa



    HEK293T cell lysates were generated from transient transfection of the cDNA clone (RC218987)

References

ab170164 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab170164.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up