Overview

  • Product name
  • Description
    Rabbit polyclonal to HAO1 / GOX
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Full length protein corresponding to Human HAO1 aa 1-370.
    Sequence:

    MLPRLICINDYEQHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLY PRMLRNVAETDLSTSVLGQRVSMPICVGATAMQRMAHVDGELATVRACQS LGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKM GYKAIFVTVDTPYLGNRLDDVRNRFKLPPQLRMKNFETSTLSFSPEENFG DDSGLAAYVAKAIDPSISWEDIKWLRRLTSLPIVAKGILRGDDAREAVKH GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV LKALALGAKAVFVGRPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQ NVKVIDKTLVRKNPLAVSKI


    Database link: NP_060015.1

  • Positive control
    • HAO1 transfected 293T cell lysate.
  • General notes

    Protein previously labeled as HAO1.

Properties

Applications

Our Abpromise guarantee covers the use of ab172573 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 41 kDa.

Target

  • Function
    Has 2-hydroxyacid oxidase activity. Most active on the 2-carbon substrate glycolate, but is also active on 2-hydroxy fatty acids, with high activity towards 2-hydroxy palmitate and 2-hydroxy octanoate.
  • Tissue specificity
    Liver.
  • Pathway
    Organic acid metabolism; glycolate degradation; 3-phospho-D-glycerate from glycolate: step 1/4.
  • Sequence similarities
    Belongs to the FMN-dependent alpha-hydroxy acid dehydrogenase family.
    Contains 1 FMN hydroxy acid dehydrogenase domain.
  • Cellular localization
    Peroxisome.
  • Information by UniProt
  • Database links
  • Alternative names
    • (S) 2 hydroxy acid oxidase antibody
    • Glycolate oxidase antibody
    • GOX antibody
    • GOX1 antibody
    • HAO1 antibody
    • HAOX1 antibody
    • HAOX1_HUMAN antibody
    • Hydroxyacid oxidase 1 antibody
    • MGC142225 antibody
    • MGC142227 antibody
    • OTTHUMP00000030231 antibody
    see all

Images

  • All lanes : Anti-HAO1 / GOX antibody (ab172573) at 1 µg/ml

    Lane 1 : HAO1 / GOX transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG (H+L), peroxidase conjugate at 1/7500 dilution

    Developed using the ECL technique.

    Predicted band size: 41 kDa

References

ab172573 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172573.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up