Overview

  • Product name

  • Description

    Rabbit polyclonal to HAO1/GOX
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HAO1/GOX aa 13-96.
    Sequence:

    QHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDL STSVLGQRVSMPICVGATAMQRMAHVDGELATVR


    Database link: Q9UJM8

  • Positive control

    • IHC-P: Human liver tissue. WB: Human liver lysate.
  • General notes

    Protein previously labeled as HAO1.

Properties

Applications

Our Abpromise guarantee covers the use of ab224577 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 41 kDa.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Has 2-hydroxyacid oxidase activity. Most active on the 2-carbon substrate glycolate, but is also active on 2-hydroxy fatty acids, with high activity towards 2-hydroxy palmitate and 2-hydroxy octanoate.
  • Tissue specificity

    Liver.
  • Pathway

    Organic acid metabolism; glycolate degradation; 3-phospho-D-glycerate from glycolate: step 1/4.
  • Sequence similarities

    Belongs to the FMN-dependent alpha-hydroxy acid dehydrogenase family.
    Contains 1 FMN hydroxy acid dehydrogenase domain.
  • Cellular localization

    Peroxisome.
  • Information by UniProt
  • Database links

  • Alternative names

    • (S) 2 hydroxy acid oxidase antibody
    • Glycolate oxidase antibody
    • GOX antibody
    • GOX1 antibody
    • HAO1 antibody
    • HAOX1 antibody
    • HAOX1_HUMAN antibody
    • Hydroxyacid oxidase 1 antibody
    • MGC142225 antibody
    • MGC142227 antibody
    • OTTHUMP00000030231 antibody
    see all

Images

  • Paraffin-embedded human liver tissue stained for HAO1/GOX using ab224577 at 1/1000 dilution in immunohistochemical analysis.

  • All lanes : Anti-HAO1/GOX antibody (ab224577) at 1/500 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Developed using the ECL technique.

    Predicted band size: 41 kDa

References

ab224577 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224577.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up