Overview

  • Product name

  • Description

    Rabbit polyclonal to HAO1/GOX
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HAO1/GOX aa 113-369. N-terminal His-tag and GST-tag; Expressed in E.coli.
    Sequence:

    SSIEEVAEAGPEALRWMQLYIYKDREISRQIVKRAEKQGYKAIFVTVDTP YLGNRIDDVRNRFKLPPQLRMKNFETNDLAFSPKGNFGDNSGLAEYVAQA IDPSLSWDDITWLRRLTSLPIVVKGILRGDDAKEAVKHGVDGILVSNHGA RQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDVLKALALGAKAVF VGRPIIWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQNVKVIDKTLVRK NPLAVSK


    Database link: Q9WU19

  • Positive control

    • WB: Mouse liver lysate; Recombinant mouse HAO1/GOX protein. IHC-P: Mouse liver, stomach and lung tissue.
  • General notes

    Protein previously labeled as HAO1.

Properties

Applications

Our Abpromise guarantee covers the use of ab233150 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Has 2-hydroxyacid oxidase activity. Most active on the 2-carbon substrate glycolate, but is also active on 2-hydroxy fatty acids, with high activity towards 2-hydroxy palmitate and 2-hydroxy octanoate.
  • Tissue specificity

    Liver.
  • Pathway

    Organic acid metabolism; glycolate degradation; 3-phospho-D-glycerate from glycolate: step 1/4.
  • Sequence similarities

    Belongs to the FMN-dependent alpha-hydroxy acid dehydrogenase family.
    Contains 1 FMN hydroxy acid dehydrogenase domain.
  • Cellular localization

    Peroxisome.
  • Information by UniProt
  • Database links

  • Alternative names

    • (S) 2 hydroxy acid oxidase antibody
    • Glycolate oxidase antibody
    • GOX antibody
    • GOX1 antibody
    • HAO1 antibody
    • HAOX1 antibody
    • HAOX1_HUMAN antibody
    • Hydroxyacid oxidase 1 antibody
    • MGC142225 antibody
    • MGC142227 antibody
    • OTTHUMP00000030231 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse stomach tissue stained for HAO1/GOX using ab233150 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse lung tissue stained for HAO1/GOX using ab233150 at 20 µg/ml in immunohistochemical analysis. AEC staining.

  • Formalin-fixed, paraffin-embedded mouse liver tissue stained for HAO1/GOX using ab233150 at 20 µg/ml in immunohistochemical analysis. AEC staining.

  • Anti-HAO1/GOX antibody (ab233150) at 1 µg/ml + Mouse liver lysate
  • Anti-HAO1/GOX antibody (ab233150) at 2 µg/ml + Recombinant mouse HAO1/GOX protein

References

ab233150 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233150.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up