Overview

  • Product name

    Anti-HAPLN4 antibody
  • Description

    Rabbit polyclonal to HAPLN4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HAPLN4 aa 216-267.
    Sequence:

    DGSVQYPVNRPREPCGGLGGTGSAGGGGDANGGLRNYGYRHNAEERYDAF CF


    Database link: Q86UW8

  • Positive control

    • Human cerebellum tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab188148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Binds to hyaluronic acid and may be involved in formation of the extracellular matrix.
  • Tissue specificity

    Expressed predominantly in brain.
  • Sequence similarities

    Belongs to the HAPLN family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 2 Link domains.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Brain link protein 2 antibody
    • BRAL 2 antibody
    • BRAL2 antibody
    • HAPLN 4 antibody
    • Hapln4 antibody
    • HPLN4_HUMAN antibody
    • Hyaluronan and proteoglycan link protein 4 antibody
    • Hyaluronan and proteoglycan link protein 4 precursor antibody
    • KIAA1926 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin embedded Human cerebellum tissue labeling HAPLN4 with ab188148 antibody at a dilution of 1/50.

References

ab188148 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188148.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up