Overview

  • Product name

  • Description

    Rabbit polyclonal to Haptoglobin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Rat Haptoglobin aa 104-346. His-tag and T7 tag. Expressed in E. coli.
    Sequence:

    IGGSMDAKGSFPWQAKMISRHGLTTGATLISDQWLLTTAQNLFLNHSENA TAKDIAPTLTLYVGKNQLVEIEKVVLHPERSVVDIGLIKLKQKVLVTEKV MPICLPSKDYVAPGRMGYVSGWGRNVNFRFTERLKYVMLPVADQEKCE LHYEKSTVPEKKGAVSPVGVQPILNKHTFCAGLTKYEEDTCYGDAGSAFA VHDTEEDTWYAAGILSFDKSCAVAEYGVYVRATDLKDWVQETMAK


    Database link: P06866

  • Positive control

    • WB: Recombinant rat Haptoglobin protein; mouse liver lysate; rat serum; HepG2 cell lysate. IHC-P: Rat testis stomach, liver and spleen tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231000 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 37 kDa.

Target

  • Function

    As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an Antimicrobial; Antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidely cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway.
    Uncleaved haptoglogin, also known as zonulin, plays a role in intestinal permeability, allowing intercellular tight junction disassembly, and controlling the equilibrium between tolerance and immunity to non-self antigens.
  • Tissue specificity

    Expressed by the liver and secreted in plasma.
  • Involvement in disease

    Anhaptoglobinemia
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
    Contains 2 Sushi (CCP/SCR) domains.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Binding peptide antibody
    • BP antibody
    • Haptoglobin alpha chain antibody
    • Haptoglobin alpha(1S) beta antibody
    • Haptoglobin alpha(2FS) beta antibody
    • Haptoglobin beta chain antibody
    • Haptoglobin, alpha polypeptide antibody
    • Haptoglobin, beta polypeptide antibody
    • HP antibody
    • HP2 ALPHA2 antibody
    • HP2ALPHA2 antibody
    • HPA1S antibody
    • HPT antibody
    • HPT_HUMAN antibody
    • MGC111141 antibody
    • Zonulin antibody
    see all

Images

  • Anti-Haptoglobin antibody (ab231000) at 2 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Predicted band size: 37 kDa

  • Formalin-fixed, paraffin-embedded rat stomach tissue stained for Haptoglobin with ab231000 at 20 μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded rat testis tissue stained for Haptoglobin with ab231000 at 20 μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for Haptoglobin with ab231000 at 20 μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded rat spleen tissue stained for Haptoglobin with ab231000 at 20 μg/ml in immunohistochemical analysis.

  • Anti-Haptoglobin antibody (ab231000) at 2 µg/ml + Mouse liver lysate

    Predicted band size: 37 kDa

  • Anti-Haptoglobin antibody (ab231000) at 2 µg/ml + Rat serum

    Predicted band size: 37 kDa

  • Anti-Haptoglobin antibody (ab231000) at 2 µg/ml + Recombinant rat Haptoglobin

    Predicted band size: 37 kDa

References

This product has been referenced in:

  • Tveitarås MK  et al. Protein expression profiling of plasma and lungs at different stages of metastatic development in a human triple negative breast cancer xenograft model. PLoS One 14:e0215909 (2019). Read more (PubMed: 31042781) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231000.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up