Overview

  • Product name

  • Description

    Rabbit polyclonal to Haptoglobin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Pig
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Pig Haptoglobin aa 123-307. (Expressed in E.coli).
    Sequence:

    HHNLTSGATLINEQWLLTTAKNLRLGHKNDTKAKDIAPTLRLYVGKKQEV EIEKVIFHPDNSTVDIGLIKLKQKVPVNERVMPICLPSKDYVNVGLVGYV SGWGRNANLNFTEHLKYVMLPVADQEKCVQYYEGSTVPEKKTPKSPVGVQ PILNEHTFCAGLSKYQEDTCYGDAGSAFAVHDKDD


    Database link: Q8SPS7

  • Positive control

    • WB: Pig liver, lung and cerebrum lysates; Pig serum; Recombinant pig Haptoglobin protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231013 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231013 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 38 kDa.

Target

  • Function

    As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an Antimicrobial; Antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidely cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway.
    Uncleaved haptoglogin, also known as zonulin, plays a role in intestinal permeability, allowing intercellular tight junction disassembly, and controlling the equilibrium between tolerance and immunity to non-self antigens.
  • Tissue specificity

    Expressed by the liver and secreted in plasma.
  • Involvement in disease

    Anhaptoglobinemia
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
    Contains 2 Sushi (CCP/SCR) domains.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Alternative names

    • Binding peptide antibody
    • BP antibody
    • Haptoglobin alpha chain antibody
    • Haptoglobin alpha(1S) beta antibody
    • Haptoglobin alpha(2FS) beta antibody
    • Haptoglobin beta chain antibody
    • Haptoglobin, alpha polypeptide antibody
    • Haptoglobin, beta polypeptide antibody
    • HP antibody
    • HP2 ALPHA2 antibody
    • HP2ALPHA2 antibody
    • HPA1S antibody
    • HPT antibody
    • HPT_HUMAN antibody
    • MGC111141 antibody
    • Zonulin antibody
    see all

Images

  • Anti-Haptoglobin antibody (ab231013) at 1 µg/ml + Pig lung lysate

    Predicted band size: 38 kDa

  • Anti-Haptoglobin antibody (ab231013) at 1 µg/ml + Pig liver lysate

    Predicted band size: 38 kDa

  • Anti-Haptoglobin antibody (ab231013) at 1 µg/ml + Pig serum

    Predicted band size: 38 kDa

  • Anti-Haptoglobin antibody (ab231013) at 1 µg/ml + Pig cerebrum lysate

    Predicted band size: 38 kDa

  • Anti-Haptoglobin antibody (ab231013) at 1 µg/ml + Recombinant pig Haptoglobin protein

    Predicted band size: 38 kDa

References

ab231013 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231013.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up