Overview

  • Product name
  • Description
    Rabbit polyclonal to Haptoglobin
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Pig
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Mouse Haptoglobin aa 118-281. (Expressed in E.coli).
    Sequence:

    AKMISRHGLTTGATLISDQWLLTTAKNLFLNHSETASAKDITPTLTLYVG KNQLVEIEKVVLHPNHSVVDIGLIKLKQRVLVTERVMPICLPSKDYIAPG RVGYVSGWGRNANFRFTDRLKYVMLPVADQDKCVVHYENSTVPEKKNLTS PVGVQPILNEHTFC


    Database link: Q61646

  • Positive control
    • WB: Recombinant mouse Haptoglobin protein; Mouse liver and lung lysates; Pig liver lysate; Mouse serum. IHC-P: Mouse liver tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab231976 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231976 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 39 kDa.

Target

  • Function
    As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an Antimicrobial; Antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidely cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway.
    Uncleaved haptoglogin, also known as zonulin, plays a role in intestinal permeability, allowing intercellular tight junction disassembly, and controlling the equilibrium between tolerance and immunity to non-self antigens.
  • Tissue specificity
    Expressed by the liver and secreted in plasma.
  • Involvement in disease
    Anhaptoglobinemia
  • Sequence similarities
    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
    Contains 2 Sushi (CCP/SCR) domains.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Binding peptide antibody
    • BP antibody
    • Haptoglobin alpha chain antibody
    • Haptoglobin alpha(1S) beta antibody
    • Haptoglobin alpha(2FS) beta antibody
    • Haptoglobin beta chain antibody
    • Haptoglobin, alpha polypeptide antibody
    • Haptoglobin, beta polypeptide antibody
    • HP antibody
    • HP2 ALPHA2 antibody
    • HP2ALPHA2 antibody
    • HPA1S antibody
    • HPT antibody
    • HPT_HUMAN antibody
    • MGC111141 antibody
    • Zonulin antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse liver tissue stained for Haptoglobin using ab231976 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Haptoglobin antibody (ab231976) at 2 µg/ml + Recombinant mouse Haptoglobin protein

    Predicted band size: 39 kDa

  • Anti-Haptoglobin antibody (ab231976) at 2 µg/ml + Pig liver lysate

    Predicted band size: 39 kDa

  • Anti-Haptoglobin antibody (ab231976) at 2 µg/ml + Mouse liver lysate

    Predicted band size: 39 kDa

  • Anti-Haptoglobin antibody (ab231976) at 2 µg/ml + Mouse lung lysate

    Predicted band size: 39 kDa

  • Anti-Haptoglobin antibody (ab231976) at 2 µg/ml + Mouse serum

    Predicted band size: 39 kDa

References

ab231976 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231976.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up