Overview

  • Product name

  • Description

    Rabbit polyclonal to HARS2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human HARS2 aa 34-506. Full length chain without transit peptide.
    Sequence:

    QSQVAEAVLTSQLKAHQEKPNFIIKTPKGTRDLSPQHMVVREKILDLVIS CFKRHGAKGMDTPAFELKETLTEKYGEDSGLMYDLKDQGGELLSLRYDLT VPFARYLAMNKVKKMKRYHVGKVWRRESPTIVQGRYREFCQCDFDIAGQF DPMIPDAECLKIMCEILSGLQLGDFLIKVNDRRIVDGMFAVCGVPESKFR AICSSIDKLDKMAWKDVRHEMVVKKGLAPEVADRIGDYVQCHGGVSLVEQ MFQDPRLSQNKQALEGLGDLKLLFEYLTLFGIADKISFDLSLARGLDYYT GVIYEAVLLQTPTQAGEEPLNVGSVAAGGRYDGLVGMFDPKGHKVPCVGL SIGVERIFYIVEQRMKTKGEKVRTTETQVFVATPQKNFLQERLKLIAELW DSGIKAEMLYKNNPKLLTQLHYCESTGIPLVVIIGEQELKEGVIKIRSVA SREEVAIKRENFVAEIQKRLSES


    Database link: P49590-1

  • Positive control

    • WB: Mouse kidney tissue. IHC-P: Human breast cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236576 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000.

Target

  • Tissue specificity

    A high level expression is seen in the heart, kidney and skeletal muscle while a lower level expression is seen in the brain and liver.
  • Sequence similarities

    Belongs to the class-II aminoacyl-tRNA synthetase family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4631412B19Rik antibody
    • AI593507 antibody
    • HARS related antibody
    • Hars2 antibody
    • HARSL antibody
    • HARSR antibody
    • HisRS antibody
    • Histidine translase antibody
    • Histidine tRNA ligase antibody
    • Histidine tRNA ligase homolog antibody
    • Histidine tRNA ligase like antibody
    • Histidine--tRNA ligase antibody
    • Histidine--tRNA ligase-like antibody
    • Histidyl tRNA synthetase 2 antibody
    • Histidyl tRNA synthetase 2 mitochondrial antibody
    • Histidyl tRNA synthetase like antibody
    • HO3 antibody
    • mitochondrial antibody
    • Probable histidyl tRNA synthetase mitochondrial antibody
    • Probable histidyl-tRNA synthetase antibody
    • SYHM_HUMAN antibody
    see all

Images

  • Anti-HARS2 antibody (ab236576) + Mouse kidney tissue lysate

    Secondary
    Goat polyclonal to Rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human breast cancer tissue stained for HARS2 with ab236576 at a 1/100 dilution in immunohistochemical analysis.

References

ab236576 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236576.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up