Overview

  • Product name
  • Description
    Mouse polyclonal to Haspin
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length native protein (purified) corresponding to Human Haspin aa 1-798.
    Sequence:

    MAASLPGPGSRLFRTYGAADGRRQRRPGREAAQWFPPQDRRRFFNSSGSS DASIGDPSQSDDPDDPDDPDFPGSPVRRRRRCPGGRVPKDRPSLTVTPKR WKLRARPSLTVTPRRLGLRARPPQKCSTPCGPLRLPPFPSRDSGRLSPDL SVCGQPRDGDELGISASLFSSLASPCPGSPTPRDSVISIGTSACLVAASA VPSDLHLPEVSLDRASLPCSQEEATGGAKDTRMVHQTRASLRSVLFGLMN SGTPEDSEFRADGKNMRESCCKRKLVVGNGPEGPGLSSTGKRRATGQDSC QERGLQEAVRREHQEASVPKGRIVPRGTDRLERTRSSRESKHQEATETSL LHSHRFKKGQKLGKDSFPTQDLTPLQNACFWTKTRASFSFHKKKIVTDVS EVCSIYTTATSLSGSLLSECSNRPVMNRTSGAPSSWHSSSMYLLSPLNTL SISNKKASDAEKVYGECSQKGPVPFSHCLPTEKLQRCEKIGEGVFGEVFQ TIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVC NRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLF IVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDL HWGNVLLKKTSLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVV FCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTD KMLKQMTFKTKCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK


    Database link: Q8TF76

  • Positive control
    • Lysate of 293T cells transfected with Haspin.

Properties

Applications

Our Abpromise guarantee covers the use of ab167204 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 88 kDa.

Target

  • Function
    Required for normal alignment of chromosomes at metaphase. Phosphorylates histone H3 'Thr-3' during mitosis.
  • Tissue specificity
    Strongly expressed in testis. Also present in thymus and bone marrow and low levels observed in prostate, intestine, lung, spleen and lymph node. Expressed in fetal skin, liver, kidney and small intestine and also in proliferating but not non-proliferating cell lines.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. Haspin subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated on both serine and threonine residues (By similarity). Phosphorylated during mitosis. Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • germ cell associated 2 antibody
    • Germ cell-specific gene 2 protein antibody
    • GSG2 antibody
    • H-haspin antibody
    • Haploid germ cell-specific nuclear protein kinase antibody
    • HASP_HUMAN antibody
    • Serine/threonine-protein kinase haspin antibody
    see all

Images

  • All lanes : Anti-Haspin antibody (ab167204) at 1 µg/ml

    Lane 1 : Lysate of 293T cells transfected with Haspin.
    Lane 2 : Lysate of 293T cells (non-transfected)

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat anti-mouse HRP conjugated antibody at 1/2500 dilution

    Predicted band size: 88 kDa

References

ab167204 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167204.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up