Overview

  • Product name

  • Description

    Rabbit polyclonal to Haspin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Haspin aa 40-129.
    Sequence:

    QHRRRFFNSSGSSDASIGDPSQSDDPDDPDDPDFPGSPVRRRRRCPGGRV PKDRPSLTVTPKRWKLRARPSLTVTPRRLGLRARPPQKCSTP


    Database link: Q8TF76

  • Positive control

    • ICC/IF: A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab226222 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Required for normal alignment of chromosomes at metaphase. Phosphorylates histone H3 'Thr-3' during mitosis.
  • Tissue specificity

    Strongly expressed in testis. Also present in thymus and bone marrow and low levels observed in prostate, intestine, lung, spleen and lymph node. Expressed in fetal skin, liver, kidney and small intestine and also in proliferating but not non-proliferating cell lines.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. Haspin subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated on both serine and threonine residues (By similarity). Phosphorylated during mitosis. Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • germ cell associated 2 antibody
    • Germ cell-specific gene 2 protein antibody
    • GSG2 antibody
    • H-haspin antibody
    • Haploid germ cell-specific nuclear protein kinase antibody
    • HASP_HUMAN antibody
    • Serine/threonine-protein kinase haspin antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for Haspin (green) using ab226222 at 4 µg/ml in ICC/IF.

References

ab226222 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (HeLa)
Gel Running Conditions
Reduced Denaturing (4-12%)
Loading amount
50000 cells
Treatment
Not treated or treated with 100 nM nocodazole for 16hrs
Specification
HeLa
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C

Miss. Rebecca Harris

Verified customer

Submitted Nov 09 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up