Overview

  • Product name

  • Description

    Rabbit polyclonal to HBE
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Sheep, Rabbit, Goat, Horse, Cow, Cat, Dog, Human, Pig, African green monkey, Spider monkey
  • Immunogen

    Synthetic peptide corresponding to Rat HBE aa 1-50 (N terminal).
    Sequence:

    MVNFTAEEKSLINGLWSKVNVEEVGGEALGRLLVVYPWTQRFFDSFGNLS

  • Positive control

    • Rat stomach lysate.
  • General notes

     This product was previously labelled as Hemoglobin subunit epsilon

     

Properties

Applications

Our Abpromise guarantee covers the use of ab136624 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 15 kDa.

Target

Images

  • Anti-HBE antibody (ab136624) at 1 µg/ml + Rat stomach lysate at 10 µg

    Predicted band size: 15 kDa

References

ab136624 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab136624.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up