Overview

  • Product name
  • Description
    Rabbit polyclonal to HBP
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human HBP aa 69-126 (internal sequence).
    Sequence:

    TNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDK SVKIEERE


    Database link: Q9NRV9

  • Positive control
    • Human duodenum tissue
  • General notes

    Product previously known as Rabbit polyclonal to HEBP1.

Properties

Applications

Our Abpromise guarantee covers the use of ab185568 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    May bind free porphyrinogens that may be present in the cell and thus facilitate removal of these potentially toxic compound. Binds with a high affinity to one molecule of heme or porphyrins. It binds metalloporphyrins, free porphyrins and N-methylprotoporphyrin with similar affinities.
  • Sequence similarities
    Belongs to the HEBP family.
  • Domain
    Forms a distorted beta-barrel structure, with two helices that are packed against the outer surface of the barrel. Porphyrins are expected to bind to a hydrophobic patch on the outer surface of the beta-barrel structure.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • HBP antibody
    • HEBP antibody
    • Hebp1 antibody
    • HEBP1_HUMAN antibody
    • Heme binding protein 1 antibody
    • Heme-binding protein 1 antibody
    • p22HBP antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human duodenum tissue labeling HBP with ab185568 at 1/50 dilution.

References

ab185568 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185568.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up