Overview

  • Product name
  • Description
    Mouse polyclonal to HBZ
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Full length protein corresponding to Human HBZ aa 1-142. (NP_005323.1)
    Sequence:

    MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLH PGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFK LLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR


    Database link: P02008

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Purity
    Whole antiserum
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab172029 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 16 kDa.

Target

Images

  • All lanes : Anti-HBZ antibody (ab172029) at 1/500 dilution

    Lane 1 : HBZ-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate at 1/2500 dilution

    Predicted band size: 16 kDa

References

ab172029 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172029.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up