Overview

  • Product name

  • Description

    Rabbit polyclonal to HC-II
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Rabbit
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human HC-II aa 276-499. Expressed in E. coli. N-terminal tags.
    Sequence:

    ALENIDPATQMMILNCIYFKGSWVNKFPVEMTHNHNFRLNEREVVKVSMM QTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQLTPR VVERWQKSMTNRTREVLLPKFKLEKNYNLVESLKLMGIRMLFDKNGNMAG ISDQRIAIDLFKHQGTITVNEEGTQATTVTTVGFMPLSTQVRFTVDRPFL FLIYEHRTSCLLFMGRVANPSRS


    Database link: P05546

  • Positive control

    • IHC-P: Human liver tissue. WB: Recombinant human HC-II protein. Pig lung, liver and kidney tissue lysate. Human serum.
  • General notes

    Protein previously labeled as Heparin Cofactor II.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232859 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Thrombin inhibitor activated by the glycosaminoglycans, heparin or dermatan sulfate. In the presence of the latter, HC-II becomes the predominant thrombin inhibitor in place of antithrombin III (AT-III). Also inhibits chymotrypsin, but in a glycosaminoglycan-independent manner.
    Peptides at the N-terminal of HC-II have chemotactic activity for both monocytes and neutrophils.
  • Tissue specificity

    Expressed predominantly in liver. Also present in plasma.
  • Involvement in disease

    Thrombophilia due to heparin cofactor 2 deficiency
  • Sequence similarities

    Belongs to the serpin family.
  • Domain

    The N-terminal acidic repeat region mediates, in part, the glycosaminoglycan-accelerated thrombin inhibition.
  • Post-translational
    modifications

    Phosphorylation sites are present in the extracellular medium.
  • Information by UniProt
  • Database links

  • Alternative names

    • D22S673 antibody
    • HC II antibody
    • HC-II antibody
    • HC2 antibody
    • HCF2 antibody
    • HEP2_HUMAN antibody
    • Heparin cofactor 2 antibody
    • Heparin cofactor II antibody
    • HLS2 antibody
    • Leuserpin 2 antibody
    • LS2 antibody
    • Protease inhibitor leuserpin 2 antibody
    • Protease inhibitor leuserpin-2 antibody
    • serine (or cysteine) proteinase inhibitor, clade D (heparin cofactor), member 1 antibody
    • Serpin D1 antibody
    • serpin peptidase inhibitor, clade D (heparin cofactor), member 1 antibody
    • SERPIND1 antibody
    • THPH10 antibody
    see all

Images

  • All lanes : Anti-HC-II antibody (ab232859) at 1 µg/ml

    Lane 1 : Human serum
    Lane 2 : Pig lung tissue lysate
    Lane 3 : Pig liver tissue lysate
    Lane 4 : Pig kidney tissue lysate

    Secondary
    All lanes : HRP-linked Guinea pig anti-Rabbit at 1/1000 dilution
  • Formalin-fixed, paraffin-embedded human liver tissue stained for HC-II with ab232859 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for HC-II with ab232859 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-HC-II antibody (ab232859) at 2 µg/ml + Recombinant human HC-II protein

References

ab232859 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232859.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up