Overview

  • Product name

  • Description

    Rabbit polyclonal to hCAP-D3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human hCAP-D3 aa 688-784.
    Sequence:

    AFHIWSKKEKFSPTFINNVISHTGTEHSAPAWMLLSKIAGSSPRLDYSRI IQSWEKISSQQNPNSNTLGHILCVIGHIAKHLPKSTRDKVTDAVKCK


    Database link: P42695

  • Positive control

    • HEK 293 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220241 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

  • Function

    Regulatory subunit of the condensin-2 complex, a complex which establishes mitotic chromosome architecture and is involved in physical rigidity of the chromatid axis.
  • Sequence similarities

    Contains 4 HEAT repeats.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CAP D3 antibody
    • CAPD 3 antibody
    • CAPD3 antibody
    • CNDD3_HUMAN antibody
    • Condensin II complex subunit D3 antibody
    • Condensin-2 complex subunit D3 antibody
    • FLJ42888 antibody
    • hCAP-D3 antibody
    • Hcp 6 antibody
    • Hcp6 antibody
    • hHCP 6 antibody
    • hHCP6 antibody
    • KIAA0056 antibody
    • MGC104671 antibody
    • NCAPD 3 antibody
    • Ncapd3 antibody
    • Non SMC condensin II complex subunit D3 antibody
    • Non-SMC condensin II complex subunit D3 antibody
    • OTTHUMP00000235403 antibody
    • OTTHUMP00000235404 antibody
    see all

Images

  • ab220241 staining hCAP-D3 in the HeLacell line from Human by ICC/IF (Immunocytochemistry/immunofluorescence). Cells were fixed with Paraformaldehyde , permeabilized with 0.5% Triton X-100. Samples were incubated with primary antibody (1/200) for 16 hour at 22°C. Ab150081 Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) preadsorbed polyclonal was used as the secondary antibody (1/200).

    See Abreview

  • Immunofluorescent analysis of HEK 293 cells (PFA-fixed/Triton X-100 permeabilized) labeling hCAP-D3 with ab220241 at 4μg/ml (green).

References

ab220241 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (HeLa)
Permeabilization
Yes - 0.5% Triton X-100
Specification
HeLa
Fixative
Paraformaldehyde

Dr. Kirk Mcmanus

Verified customer

Submitted Jan 02 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up