Overview

  • Product name

    Anti-HCC-8 antibody
  • Description

    Rabbit polyclonal to HCC-8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HCC-8 aa 226-325.
    Sequence:

    ECVPILRELAGVEQALGLHDVSINHFLQAHLIILSRSPSQVEAADSAHIV AHAAVASGRHEHHDVAEQYFQESMAHLKDSEGMGRTKFLSIQDEFCHFLQ


    Database link: Q5W5X9

  • Positive control

    • IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab243431 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Sequence similarities

    Contains 4 TPR repeats.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cervical cancer proto oncogene 8 protein antibody
    • Cervical cancer proto-oncogene 8 protein antibody
    • HCC 8 antibody
    • HCC-8 antibody
    • OTTHUMP00000190851 antibody
    • Protooncogene 8 antibody
    • Tetratricopeptide repeat domain 23 antibody
    • Tetratricopeptide repeat protein 23 antibody
    • TPR repeat protein 23 antibody
    • Ttc23 antibody
    • TTC23_HUMAN antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for HCC-8 using ab243431 at 1/50 dilution in immunohistochemical analysis.

References

ab243431 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243431.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up