Anti-HCCS antibody (ab234874)
Key features and details
- Rabbit polyclonal to HCCS
- Suitable for: WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-HCCS antibody
See all HCCS primary antibodies -
Description
Rabbit polyclonal to HCCS -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant full length protein corresponding to Human HCCS aa 1-268.
Sequence:MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKT YSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFAL STVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNI IRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRS WMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALD SLSAVWDRMKVAWWRWTS
Database link: P53701 -
Positive control
- WB: Mouse small intestine, heart and skeletal muscle lysate; HeLa, RAW 264.7, MCF7 and HepG2 cell lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
- HeLa whole cell lysate (ab150035)
- HepG2 whole cell lysate (ab166833)
- MCF7 whole cell lysate (ab29537)
- HeLa whole cell lysate (ab29545)
- Mouse small intestine normal tissue lysate - total protein (ab29707)
- Mouse skeletal muscle tissue lysate - total protein (ab29711)
- Mouse heart normal tissue lysate - total protein (ab30291)
- RAW 264.7 whole cell lysate (ab7187)
- Mouse small intestine tissue lysate - total protein (ab7939)
Applications
Our Abpromise guarantee covers the use of ab234874 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/1000 - 1/5000. Predicted molecular weight: 31 kDa. |
Target
-
Function
Links covalently the heme group to the apoprotein of cytochrome c. -
Involvement in disease
Microphthalmia, syndromic, 7 -
Sequence similarities
Belongs to the cytochrome c-type heme lyase family.
Contains 2 HRM (heme regulatory motif) repeats. -
Cellular localization
Mitochondrion inner membrane. - Information by UniProt
-
Database links
- Entrez Gene: 3052 Human
- Entrez Gene: 15159 Mouse
- Omim: 300056 Human
- SwissProt: P53701 Human
- SwissProt: P53702 Mouse
- Unigene: 211571 Human
- Unigene: 284033 Mouse
-
Alternative names
- CCHL antibody
- CCHL_HUMAN antibody
- cytochrome c heme-lyase antibody
see all
Images
-
All lanes : Anti-HCCS antibody (ab234874) at 1/1000 dilution
Lane 1 : Mouse small intestine lysate
Lane 2 : Mouse heart lysate
Lane 3 : Mouse skeletal muscle lysate
Lane 4 : HeLa (Human epithelial cell line from cervix adenocarcinoma) cell lysate
Lane 5 : RAW 264.7 (Mouse macrophage cell line transformed with Abelson murine leukemia virus) cell lysate
Lane 6 : MCF7 (Human breast adenocarcinoma cell line) cell lysate
Lane 7 : HepG2 (Human liver hepatocellular carcinoma cell line) cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
Predicted band size: 31 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab234874 has not yet been referenced specifically in any publications.