Anti-HCCS antibody (ab234874)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-HCCS antibody
See all HCCS primary antibodies -
Description
Rabbit polyclonal to HCCS -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant full length protein corresponding to Human HCCS aa 1-268.
Sequence:MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKT YSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFAL STVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNI IRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRS WMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALD SLSAVWDRMKVAWWRWTS
Database link: P53701 -
Positive control
- WB: Mouse small intestine, heart and skeletal muscle lysate; HeLa, RAW 264.7, MCF7 and HepG2 cell lysate.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.3
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
- HeLa whole cell lysate (ab150035)
- HepG2 whole cell lysate (ab166833)
- MCF7 whole cell lysate (ab29537)
- HeLa whole cell lysate (ab29545)
- Mouse small intestine normal tissue lysate - total protein (ab29707)
- Mouse skeletal muscle tissue lysate - total protein (ab29711)
- Mouse heart normal tissue lysate - total protein (ab30291)
- MCF7 whole cell lysate (ab3871)
- RAW 264.7 whole cell lysate (ab7187)
- HepG2 whole cell lysate (ab7900)
- Mouse small intestine tissue lysate - total protein (ab7939)
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab234874 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/1000 - 1/5000. Predicted molecular weight: 31 kDa. |
Target
-
Function
Links covalently the heme group to the apoprotein of cytochrome c. -
Involvement in disease
Microphthalmia, syndromic, 7 -
Sequence similarities
Belongs to the cytochrome c-type heme lyase family.
Contains 2 HRM (heme regulatory motif) repeats. -
Cellular localization
Mitochondrion inner membrane. - Information by UniProt
-
Database links
- Entrez Gene: 3052 Human
- Entrez Gene: 15159 Mouse
- Omim: 300056 Human
- SwissProt: P53701 Human
- SwissProt: P53702 Mouse
- Unigene: 211571 Human
- Unigene: 284033 Mouse
-
Alternative names
- CCHL antibody
- CCHL_HUMAN antibody
- cytochrome c heme-lyase antibody
see all
Images
-
Western blot - Anti-HCCS antibody (ab234874)All lanes : Anti-HCCS antibody (ab234874) at 1/1000 dilution
Lane 1 : Mouse small intestine lysate
Lane 2 : Mouse heart lysate
Lane 3 : Mouse skeletal muscle lysate
Lane 4 : HeLa (Human epithelial cell line from cervix adenocarcinoma) cell lysate
Lane 5 : RAW 264.7 (Mouse macrophage cell line transformed with Abelson murine leukemia virus) cell lysate
Lane 6 : MCF7 (Human breast adenocarcinoma cell line) cell lysate
Lane 7 : HepG2 (Human liver hepatocellular carcinoma cell line) cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
Predicted band size: 31 kDa
Datasheets and documents
References
ab234874 has not yet been referenced specifically in any publications.
