Overview

  • Product name

    Anti-hCG alpha antibody [HCGa/53]
    See all hCG alpha primary antibodies
  • Description

    Mouse monoclonal [HCGa/53] to hCG alpha
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human hCG alpha aa 1-116.
    Sequence:

    MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPIL QCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKV ENHTACHCSTCYYHKS


    Database link: P01215

  • Positive control

    • Human placenta tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab201329 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.5 - 1 µg/ml. Predicted molecular weight: 13 kDa.

Target

  • Sequence similarities

    Belongs to the glycoprotein hormones subunit alpha family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Anterior pituitary glycoprotein hormones common subunit alpha antibody
    • CG alpha antibody
    • CG-alpha antibody
    • cga antibody
    • Choriogonadotropin alpha chain antibody
    • Chorionic Gonadotrophin Alpha antibody
    • Chorionic Gonadotrophin Alpha Subunit antibody
    • Chorionic gonadotrophin subunit alpha antibody
    • chorionic gonadotropin, alpha polypeptide antibody
    • Follicle-stimulating hormone alpha antibody
    • Follicle-stimulating hormone alpha chain antibody
    • follicle-stimulating hormone alpha subunit antibody
    • Follitropin alpha antibody
    • Follitropin alpha chain antibody
    • FSH Alpha antibody
    • FSH-alpha antibody
    • FSHA antibody
    • GLHA_HUMAN antibody
    • Glycoprotein hormones alpha chain antibody
    • Glycoprotein Hormones Alpha Polypeptide antibody
    • GPH Alpha antibody
    • GPHa antibody
    • GPHA1 antibody
    • HCG antibody
    • hyrotropin alpha antibody
    • LH-alpha antibody
    • LHA antibody
    • LSH alpha antibody
    • LSH-alpha antibody
    • Luteinizing hormone alpha antibody
    • Luteinizing hormone alpha chain antibody
    • Lutropin alpha antibody
    • Lutropin alpha chain antibody
    • Thyroid Stimulating Hormone Alpha antibody
    • Thyroid Stimulating Hormone Alpha Chain antibody
    • Thyroid-stimulating hormone alpha chain antibody
    • Thyrotropin alpha chain antibody
    • TSH Alpha antibody
    • TSH-alpha antibody
    • TSHA antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded human placenta tissue, labeling hCG alpha using ab201329 at 1 µg/mL.

References

ab201329 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201329.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up