Overview

  • Product name

  • Description

    Rabbit polyclonal to hCG beta
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human hCG beta aa 59-90.
    Sequence:

    PTMTRVLQGVLPALPQVVCNYRDVRFESIRLP


    Database link: P0DN86-1

  • Positive control

    • IHC-P: Human placenta tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab243743 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Function: Stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. Tissue specificity: Placenta. Similarity: Belongs to the glycoprotein hormones subunit beta family. Developmental stage: Made by the first trimester placenta.
  • Database links

  • Alternative names

    • CG beta antibody
    • CG-beta antibody
    • CgB antibody
    • CGB3 antibody
    • CGB3_HUMAN antibody
    • CGB5 antibody
    • CGB7 antibody
    • CGB7_HUMAN antibody
    • CGB8 antibody
    • CGHB_HUMAN antibody
    • Choriogonadotropin subunit beta 3 antibody
    • Choriogonadotropin subunit beta 7 antibody
    • Choriogonadotropin subunit beta antibody
    • Chorionic gonadotropin beta polypeptide antibody
    • Chorionic gonadotropin chain beta antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human placenta tissue stained for hCG beta with ab243743 at a 1/1000 dilution in immunohistochemical analysis.

  • PFA fixed, Triton X-100 permeabilized U-2 OS (Human bone osteosarcoma epithelial cell line) cells labeling hCG beta using ab243743 at 4 µg/ml (green) in ICC/IF.

References

ab243743 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243743.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up