Overview

  • Product name

    Anti-hCG receptor/LHR antibody - C-terminal
    See all hCG receptor/LHR primary antibodies
  • Description

    Rabbit polyclonal to hCG receptor/LHR - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Goat, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human hCG receptor/LHR aa 636-685 (C terminal). The exact sequence is proprietary.
    Sequence:

    LLLSKFGCCKRRAELYRRKDFSAYTSNCKNGFTGSNKPSQSTLKLSTLHC


    Database link: P22888

  • Positive control

    • THP-1 whole cell lysate.
  • General notes

     This product was previously labelled as hCG receptor

     

Properties

Applications

Our Abpromise guarantee covers the use of ab179780 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 79, 72 kDa.

Target

  • Function

    Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
  • Tissue specificity

    Gonadal and thyroid cells.
  • Involvement in disease

    Defects in LHCGR are a cause of familial male precocious puberty (FMPP) [MIM:176410]; also known as testotoxicosis. In FMPP the receptor is constitutively activated.
    Defects in LHCGR are the cause of luteinizing hormone resistance (LHR) [MIM:238320]; also known as Leydig cell hypoplasia in males. LHR is an autosomal recessive disorder characterized by unresponsiveness to luteinizing hormone, defective sexual development in males, and defective follicular development and ovulation, amenorrhea and infertility in females. Two forms of the disorder have been defined in males. Type 1 is a severe form characterized by complete 46,XY male pseudohermaphroditism, low testosterone and high luteinizing hormone levels, total lack of responsiveness to luteinizing and chorionic gonadotropin hormones, lack of breast development, and absent development of secondary male sex characteristics. Type 2, a milder form, displays a broader range of phenotypic expression ranging from micropenis to severe hypospadias.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family. FSH/LSH/TSH subfamily.
    Contains 6 LRR (leucine-rich) repeats.
    Contains 1 LRRNT domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Gonadotropin receptor antibody
    • Gpcr19-rs1 antibody
    • GTHR-II antibody
    • HHG antibody
    • LCGR antibody
    • LGR2 antibody
    • LH-R antibody
    • LH/CG R antibody
    • LH/CG-R antibody
    • LH/CGR antibody
    • LHCGR antibody
    • LHR antibody
    • LHRHR antibody
    • LSH R antibody
    • LSH-R antibody
    • LSHR_HUMAN antibody
    • Luteinizing hormone receptor antibody
    • Luteinizing hormone/choriogonadotropin receptor antibody
    • Lutropin choriogonadotropic hormone receptor antibody
    • Lutropin choriogonadotropic receptor antibody
    • Lutropin-choriogonadotropic hormone receptor antibody
    • ULG5 antibody
    see all

Images

  • Anti-hCG receptor/LHR antibody - C-terminal (ab179780) at 1 µg/ml + THP-1 whole cell lysate at 10 µg

    Predicted band size: 79, 72 kDa

References

ab179780 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179780.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up