Overview

  • Product name

  • Description

    Mouse polyclonal to Hck
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Full length protein corresponding to Human Hck aa 1-505.
    Sequence:

    MGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLA TRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIR DSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQE LVDHYKKGNDGLCQKLSVPCMSSKPQKPWEKDAWEIPRESLKLEKKLGAG QFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLH AVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAF IEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFPI KWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALE RGYRMPRPENCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQ YQQQP


    Database link: P08631-2

  • Positive control

    • Hck transfected 293T cell line lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab171905 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 60 kDa.

Target

  • Function

    May serve as part of a signaling pathway coupling the Fc receptor to the activation of the respiratory burst. May also contribute to neutrophil migration and may regulate the degranulation process of neutrophils.
  • Tissue specificity

    Expressed predominantly in cells of the myeloid and B-lymphoid lineages.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. SRC subfamily.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
    Contains 1 SH3 domain.
  • Domain

    The SH3 domain mediates binding to HIV-1 Nef.
  • Cellular localization

    Membrane. Cytoplasm. At least half of this isoform is found in the cytoplasm, some of this fraction is myristoylated and Membrane. Membrane > caveola. 20% of this isoform is associated with caveolae, this association depends on palmitoylation of cyteine at position 3.
  • Information by UniProt
  • Database links

  • Form

    This protein is known to be similar in amino acid sequence to LCK (P06239), FYN (P06241), YES1 (P07947), SRC (P12931), and LYN (P07948). Therefore, cross-reactivity with these homologous proteins may be observed. We would be happy to provide immunogen alignment information upon request.
  • Alternative names

    • Bmk antibody
    • Hck 1 antibody
    • Hck antibody
    • HCK_HUMAN antibody
    • Hemopoietic cell kinase antibody
    • JTK9 antibody
    • p59-HCK/p60-HCK antibody
    • p59Hck antibody
    • p59HCK/p60HCK antibody
    • p61Hck antibody
    • Tyrosine protein kinase HCK antibody
    • Tyrosine-protein kinase HCK antibody
    see all

Images

  • All lanes : Anti-Hck antibody (ab171905) at 1 µg/ml

    Lane 1 : Hck transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 60 kDa

References

ab171905 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171905.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up