Overview

  • Product name

    Anti-HCN1 antibody [N70/28] - C-terminal (FITC)
    See all HCN1 primary antibodies
  • Description

    Mouse monoclonal [N70/28] to HCN1 - C-terminal (FITC)
  • Host species

    Mouse
  • Conjugation

    FITC. Ex: 493nm, Em: 528nm
  • Tested applications

    Suitable for: IHC-Fr, WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit
  • Immunogen

    Recombinant fragment corresponding to Rat HCN1 aa 778-910 (C terminal). NCBI Accession No. NP_445827.1
    Sequence:

    TPGSSTPKNEVHKSTQALHNTHLTREVRPLSASQPSLPHEVSTMISRPHP TVGESLASIPQPVATVHSTGLQAGSRSTVPQRVTLFRQMSSGAIPPNRGV PPAPPPPAAVQRESPSVLNKDPDAEKPRFASNL


    Database link: Q9JKBO

  • Positive control

    • IHC-P: Mouse cerebellum tissue; Human hippocampus tissue. IHC-Fr: Mouse brain tissue section.
  • General notes

    The clone number has been updated from S70-28 to N70/28, both clone numbers name the same antibody clone.

     

Properties

Applications

Our Abpromise guarantee covers the use of ab183408 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr Use a concentration of 0.1 - 1 µg/ml.
WB 1/1000. Predicted molecular weight: 102 kDa.

1 μg/mL of ab183408 was sufficient for detection of rat HCN1 in 10 μg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.

IHC-P 1/1000.
ICC/IF 1/100.

Target

  • Function

    Hyperpolarization-activated ion channel exhibiting weak selectivity for potassium over sodium ions. Contributes to the native pacemaker currents in heart (If) and in neurons (Ih). Activated by cAMP, and at 10-100 times higher concentrations, also by cGMP. May mediate responses to sour stimuli.
  • Tissue specificity

    Detected in brain, in particular in amygdala and hippocampus, while expression in caudate nucleus, corpus callosum, substantia nigra, subthalamic nucleus and thalamus is very low or not detectable. Detected at very low levels in muscle and pancreas.
  • Sequence similarities

    Belongs to the potassium channel HCN family.
    Contains 1 cyclic nucleotide-binding domain.
  • Domain

    The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • BCNG-1 antibody
    • BCNG1 antibody
    • Brain cyclic nucleotide gated channel 1 antibody
    • Brain cyclic nucleotide-gated channel 1 antibody
    • HAC 2 antibody
    • HAC2 antibody
    • HCN1 antibody
    • HCN1_HUMAN antibody
    • Hyperpolarization activated cyclic nucleotide gated potassium channel 1 antibody
    • Potassium channel, voltage-gated, brain, 1 antibody
    • Potassium/sodium hyperpolarization activated cyclic nucleotide gated channel 1 antibody
    • Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 antibody
    see all

References

ab183408 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab183408.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up