Overview

  • Product name

    Anti-HCP5 antibody
  • Description

    Rabbit polyclonal to HCP5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HCP5 aa 8-101.
    Sequence:

    HRNEALGNYLEMRLKSSFLRGLGSWKSNPLRLGGWTILLTLTMGQGEPGG PQGDPWVPHELLLPSLCDSSHASSWGSGSITCAWRGGDSSSHPL


    Database link: Q6MZN7

  • Positive control

    • IHC-P: Human spleen and lymph node tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223037 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    Expressed in lymphoid tissues; Detected in spleen as well as in B cell lines, NK cell lines and activated lymphocytes.
  • Database links

  • Alternative names

    • HLA class I histocompatibility antigen protein P5 antibody
    • HLA complex protein P5 antibody
    • Protein P5 1 antibody

Images

  • Paraffin-embedded human spleen tissue stained for HCP5 using ab223037 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lymph node tissue stained for HCP5 using ab223037 at 1/100 dilution in immunohistochemical analysis.

References

ab223037 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223037.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up