Overview

  • Product name

    Anti-HCV subtype 1b NS5B antibody
    See all HCV subtype 1b NS5B primary antibodies
  • Description

    Rabbit polyclonal to HCV subtype 1b NS5B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Hepatitis C virus
  • Immunogen

    Synthetic peptide within Hepatitis C Virus HCV subtype 1b NS5B aa 1400-1550 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Hepatitis C virus genotype 1b (isolate Con1).
    Sequence:

    CDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFD SVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIY RFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLP V


    Database link: Q9WMX2

  • Positive control

    • IHC-P: Mouse liver and rat colitis tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab203074 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Cellular localization

    Host cytoplasm, nucleus, mitochondrion, endoplasmatic reticulum; secreted.
  • Database links

    • Alternative names

      • Hepacivirin antibody
      • NS3P antibody
      • POLG_HCVBK antibody
      • Serine protease NS3 antibody

    Images

    • Immunohistochemical analysis of formalin-fixed paraffin-embedded mouse liver tissue, labeling HCV subtype 1b NS5B using ab203074 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

    • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat colitis tissue, labeling HCV subtype 1b NS5B using ab203074 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

    References

    ab203074 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab203074.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up