Overview

  • Product name

  • Description

    Rabbit polyclonal to HDAC10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human HDAC10 aa 540-590 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    SMFHVSTPLPVMTGGFLSCILGLVLPLAYGFQPDLVLVALGPGHGLQGPH A


    Database link: Q969S8

  • Positive control

    • Human brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab217692 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.
  • Tissue specificity

    Ubiquitous. High expression in liver, spleen, pancreas and kidney.
  • Sequence similarities

    Belongs to the histone deacetylase family. HD type 2 subfamily.
  • Cellular localization

    Cytoplasm. Nucleus. Excluded from the nucleoli.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZP761B039 antibody
    • HD 10 antibody
    • HD10 antibody
    • HDA10_HUMAN antibody
    • HDAC 10 antibody
    • Hdac10 antibody
    • Histone deacetylase 10 antibody
    • MGC149722 antibody
    • OTTHUMP00000028555 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human brain tissue, labeling HDAC10 using ab217692 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab217692 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217692.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up