Overview

  • Product name

  • Description

    Rabbit polyclonal to HDAC6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human HDAC6 aa 166-348. N-terminal tag. (Expressed in E.coli).
    Sequence:

    VLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGH HAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFD QDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMR DADYIAAFLHVLLPVALEFQPQLVLVAAGFDAL


    Database link: Q9UBN7-1

  • Positive control

    • WB: Pig kidney lysate; Recombinant human HDAC6 protein. IHC-P: Human kidney, liver and liver cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233520 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes (By similarity). Plays a central role in microtubule-dependent cell motility via deacetylation of tubulin.
  • Sequence similarities

    Belongs to the histone deacetylase family. HD type 2 subfamily.
    Contains 1 UBP-type zinc finger.
  • Post-translational
    modifications

    Ubiquitinated. Its polyubiquitination however does not lead to its degradation.
    Sumoylated in vitro.
  • Cellular localization

    Nucleus. Cytoplasm. It is mainly cytoplasmic, where it is associated with microtubules.
  • Information by UniProt
  • Database links

  • Alternative names

    • CPBHM antibody
    • FLJ16239 antibody
    • HD 6 antibody
    • HD6 antibody
    • HDAC 6 antibody
    • HDAC6 antibody
    • HDAC6_HUMAN antibody
    • Histone deacetylase 6 (HD6) antibody
    • Histone deacetylase 6 antibody
    • JM 21 antibody
    • JM21 antibody
    • KIAA0901 antibody
    • OTTHUMP00000032398 antibody
    • OTTHUMP00000197663 antibody
    • PPP1R90 antibody
    • Protein phosphatase 1 regulatory subunit 90 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for HDAC6 using ab233520 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver cancer tissue stained for HDAC6 using ab233520 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for HDAC6 using ab233520 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-HDAC6 antibody (ab233520) at 2 µg/ml + Pig kidney lysate

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution
  • Anti-HDAC6 antibody (ab233520) at 2 µg/ml + Recombinant human HDAC6 protein

References

ab233520 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233520.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up