Overview

  • Product name

  • Description

    Rabbit polyclonal to HDHD3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, Immunoelectrophoresismore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human HDHD3 aa 1-251.
    Sequence:

    MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFR QAYRAQSHSFPNYGLSHGLTSRQWWLDVVLQTFHLAGVQDAQAVAPIAEQ LYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGL REHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQG PRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGSTPG L


    Database link: Q9BSH5

  • Positive control

    • WB: Mouse small intestine and liver lysates; HT-29, HepG2 and A431 whole cell lysates. IHC-P: Human adrenal gland and small intestine tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235319 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Detects a band of approximately 28 kDa (predicted molecular weight: 28 kDa).
Immunoelectrophoresis 1/20 - 1/200.

Target

Images

  • All lanes : Anti-HDHD3 antibody (ab235319) at 1/500 dilution

    Lane 1 : Mouse small intestine lysate
    Lane 2 : HT-29 (human colorectal adenocarcinoma cell line) whole cell lysate
    Lane 3 : Mouse liver lysate
    Lane 4 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 5 : A431 whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 28 kDa
    Observed band size: 28 kDa

  • Paraffin-embedded human adrenal gland tissue stained for HDHD3 using ab235319 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for HDHD3 using ab235319 at 1/100 dilution in immunohistochemical analysis.

References

ab235319 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235319.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up