Overview

  • Product name

    Anti-HDHD3 antibody [OTI1C5]
    See all HDHD3 primary antibodies
  • Description

    Mouse monoclonal [OTI1C5] to HDHD3
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human HDHD3 aa 1-251. Produced in E.coli (NP_112496).
    Sequence:

    MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFR QAYRAQSHSFPNYGLSHGLTSRQWWLDVVLQTFHLAGVQDAQAVAPIAEQ LYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGL REHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQG PRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGSTPG L


    Database link: Q9BSH5

  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY HDHD3 cDNA for 48 hrs. IHC-P: Human breast, liver, liver carcinoma, pancreas and appendix tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab236389 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 28 kDa.
IHC-P 1/150.

Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 8.5 before commencing with IHC staining protocol.

Target

  • Sequence similarities

    Belongs to the HAD-like hydrolase superfamily.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2810435D12Rik antibody
    • C9orf158 antibody
    • Chromosome 9 open reading frame 158 antibody
    • Haloacid dehalogenase like hydrolase domain containing 3 antibody
    • Haloacid dehalogenase-like hydrolase domain-containing protein 3 antibody
    • HDHD3 antibody
    • HDHD3_HUMAN antibody
    • MGC12904 antibody
    see all

Images

  • All lanes : Anti-HDHD3 antibody [OTI1C5] (ab236389) at 1/2000 dilution

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA for 48 hrs
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY HDHD3 cDNA for 48 hrs

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 28 kDa

  • Paraffin-embedded human breast tissue stained for HDHD3 using ab236389 at 1/150 dilution in immunohistochemical analysis.  

  • Paraffin-embedded human liver tissue stained for HDHD3 using ab236389 at 1/150 dilution in immunohistochemical analysis.  

  • Paraffin-embedded human liver carcinoma tissue stained for HDHD3 using ab236389 at 1/150 dilution in immunohistochemical analysis.  

  • Paraffin-embedded human pancreas tissue stained for HDHD3 using ab236389 at 1/150 dilution in immunohistochemical analysis.  

  • Paraffin-embedded human appendix tissue stained for HDHD3 using ab236389 at 1/150 dilution in immunohistochemical analysis.  

References

ab236389 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236389.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up