Overview

  • Product name

  • Description

    Rabbit polyclonal to HDLBP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Chicken, Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human HDLBP aa 158-371. (Expressed in E.coli).
    Sequence:

    PKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEK ARHEVLLISAEQDKRAVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRIN IPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKKKKTTTIAVEVKKSQH KYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQALTEV YAKANSFTVSSVAA


    Database link: Q00341

  • Positive control

    • IHC-P: Human stomach tissue. ICC/IF: HepG2 cells. WB: Pig liver lysate; Jurkat, HeLa and HepG2 cell lysates; Recombinant human HDLBP protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab232896 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 141 kDa.
ICC/IF Use a concentration of 5 - 20 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Anti-HDLBP antibody (ab232896) at 2 µg/ml + Recombinant human HDLBP protein

    Predicted band size: 141 kDa

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for HDLBP using ab232896 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for HDLBP (green) using ab232896 at 20 µg/ml in ICC/IF, followed by FITC staining.

  • All lanes : Anti-HDLBP antibody (ab232896) at 3 µg/ml

    Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 4 : Pig liver lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/1000 dilution

    Predicted band size: 141 kDa

References

ab232896 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232896.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up