Overview

  • Product name

  • Description

    Rabbit polyclonal to HEATR3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HEATR3 aa 316-392. Numbering is from isoform 1; sequence also occurs in isoform 2 and shows 82% homology with isoform 3.
    Sequence:

    TNGDDLIEDDEMEGISHKRRVRRKTFVSDLLPPTDKELRETIALLTAQQT ALEIIVNMCCNEDPSDDEWEELSSSDE


    Database link: Q7Z4Q2

  • Positive control

    • WB; RT4 and U-251 MG cell extracts. ICC/IF; HEK293 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221085 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2500. Predicted molecular weight: 75 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

Images

  • All lanes : Anti-HEATR3 antibody (ab221085) at 1/1000 dilution

    Lane 1 : RT4 cell extract
    Lane 2 : U-251 MG cell extract

    Developed using the ECL technique.

    Predicted band size: 75 kDa

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized HEK293 cells labeling HEATR3 with ab221085 at 4 µg/ml.  Antibody staining is shown in green.  

References

ab221085 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221085.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up